Property Summary

NCBI Gene PubMed Count 72
PubMed Score 305.27
PubTator Score 393.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Disease of metabolism 18 0.0 3.0

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.0e-03
glioblastoma -1.100 4.4e-03
lung cancer -1.100 3.8e-03
medulloblastoma, large-cell -1.700 2.2e-06
osteosarcoma 1.409 1.1e-03
ovarian cancer -1.500 3.9e-06
pancreatic ductal adenocarcinoma liver m... -1.757 4.0e-03
psoriasis 1.500 1.2e-04
ulcerative colitis -1.304 5.2e-03

Gene RIF (36)

AA Sequence

MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPEDLIWHTPEGISIK      1 - 70
PLYSKRDTMDLPEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTVEESNKFYKDNIKAGQQGLSVAFDL     71 - 140
ATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSVSMTMNGAVIPVLANFIVTGEEQGVPK    141 - 210
EKLTGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYT    211 - 280
LADGLEYSRTGLQAGLTIDEFAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLRAH    281 - 350
CQTSGWSLTEQDPYNNIVRTAIEAMAAVFGGTQSLHTNSFDEALGLPTVKSARIARNTQIIIQEESGIPK    351 - 420
VADPWGGSYMMECLTNDVYDAALKLINEIEEMGGMAKAVAEGIPKLRIEECAARRQARIDSGSEVIVGVN    421 - 490
KYQLEKEDAVEVLAIDNTSVRNRQIEKLKKIKSSRDQALAERCLAALTECAASGDGNILALAVDASRARC    491 - 560
TVGEITDALKKVFGEHKANDRMVSGAYRQEFGESKEITSAIKRVHKFMEREGRRPRLLVAKMGQDGHDRG    561 - 630
AKVIATGFADLGFDVDIGPLFQTPREVAQQAVDADVHAVGISTLAAGHKTLVPELIKELNSLGRPDILVM    631 - 700
CGGVIPPQDYEFLFEVGVSNVFGPGTRIPKAAVQVLDDIEKCLEKKQQSV                        701 - 750
//

Text Mined References (79)

PMID Year Title