Property Summary

NCBI Gene PubMed Count 119
Grant Count 86
R01 Count 41
Funding $5,732,685.41
PubMed Score 339.10
PubTator Score 192.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer 1.300 0.001
Multiple myeloma 1.511 0.012
periodontitis 1.200 0.000
atypical teratoid / rhabdoid tumor 1.300 0.020
lung cancer 3.000 0.000
breast carcinoma -1.400 0.000
interstitial cystitis 1.100 0.022
lung adenocarcinoma -1.400 0.000
group 3 medulloblastoma -1.100 0.001
posterior fossa group B ependymoma 1.100 0.000
pancreatic carcinoma 1.300 0.001
lung carcinoma -1.400 0.000
non-small cell lung carcinoma -1.200 0.000
ductal carcinoma in situ -1.400 0.000
invasive ductal carcinoma -1.200 0.029

Synonym

Accession P22004 Q5TCP3 BMP-6
Symbols VGR
VGR1

Gene

PANTHER Protein Class (2)

PDB

2QCW   2R52   2R53  

Gene RIF (89)

PMID Text
26855134 These results demonstrated that Hcy up-regulated hepcidin expression through the BMP6/SMAD pathway, suggesting a novel mechanism underlying the hyperhomocysteinemia-associated perturbation of iron homeostasis.
26779985 BMP-6 upregulates somatostatin receptor actions, leading to reduction of GnRH-induced secretion of luteinizing hormone.
26751737 These observations suggest a novel role of BMP-6 in the inhibition of breast cancer metastasis by regulating secretion of MMPs(MMP-1) in the tumor microenvironment.
26598555 BMP-dependent physical interaction of VE-cadherin with the BMP receptor ALK2 (BMPRI) and BMPRII, resulting in stabilization of the BMP receptor complex and, thereby, the support of BMP6-Smad signaling.
26582087 Identify 3 heterozygous missense mutations in BMP6 in patients with unexplained iron overload. These mutations lead to loss of signaling to SMAD proteins and reduced hepcidin production.
26410368 BMP6 and oxidized low-density lipoprotein independently and synergistically induced osteogenic differentiation and mineralization in vascular endothelial cells.
25753222 These observations imply that crosstalk between the VEGF and BMP-6 signaling pathways enhances osteogenic differentiation of MSCs.
25227796 CpG island methylation of BMP6 is found in high frequency in CRC and this epigenetic event is associated with suppressed protein expression in the tumor tissue.
25121767 demonstrate that BMP6 is associated with radiographic severity in AS, supporting the role wingless-type like/BMP pathway on radiographic progression in AS
25011936 In vitro analysis revealed that recombinant BMP6 inhibited the activation of hepatic stellate cells (HSCs) and reduced proinflammatory and profibrogenic gene expression in already activated HSCs
More...

AA Sequence

MPGLGRRAQWLCWWWGLLCSCCGPPPLRPPLPAAAAAAAGGQLLGDGGSPGRTEQPPPSPQSSSGFLYRR      1 - 70
LKTQEKREMQKEILSVLGLPHRPRPLHGLQQPQPPALRQQEEQQQQQQLPRGEPPPGRLKSAPLFMLDLY     71 - 140
NALSADNDEDGASEGERQQSWPHEAASSSQRRQPPPGAAHPLNRKSLLAPGSGSGGASPLTSAQDSAFLN    141 - 210
DADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIPEGEVVTAAEFRIYKDCVMGSFKNQTFLISIYQVL    211 - 280
QEHQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGVHVHPRAAGLVGRD    281 - 350
GPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVS    351 - 420
FQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLY    421 - 490
FDDNSNVILKKYRNMVVRACGCH                                                   491 - 513
//

Text Mined References (120)

PMID Year Title
26855134 2016 Homocysteine upregulates hepcidin expression through BMP6/SMAD signaling pathway in hepatocytes.
26779985 2016 BMP-6 modulates somatostatin effects on luteinizing hormone production by gonadrotrope cells.
26751737 2016 BMP-6 inhibits the metastasis of MDA-MB-231 breast cancer cells by regulating MMP-1 expression.
26598555 2016 VE-cadherin facilitates BMP-induced endothelial cell permeability and signaling.
26582087 2016 Heterozygous Mutations in BMP6 Pro-peptide Lead to Inappropriate Hepcidin Synthesis and Moderate Iron Overload in Humans.
26410368 2015 Bone morphogenetic protein 6 and oxidized low-density lipoprotein synergistically recruit osteogenic differentiation in endothelial cells.
25753222 2015 Cross-Talk Between VEGF and BMP-6 Pathways Accelerates Osteogenic Differentiation of Human Adipose-Derived Stem Cells.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25401122 2014 Bone Morphogenetic Protein (BMP) signaling in development and human diseases.
25227796 2014 Expression of BMP6 is associated with its methylation status in colorectal cancer tissue but lacks prognostic significance.
More...