Property Summary

NCBI Gene PubMed Count 125
PubMed Score 373.21
PubTator Score 192.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 2.0e-02
breast carcinoma -1.400 2.7e-04
ductal carcinoma in situ -1.400 3.8e-05
group 3 medulloblastoma -1.100 5.4e-04
interstitial cystitis 1.100 2.2e-02
invasive ductal carcinoma -1.200 2.9e-02
lung adenocarcinoma -1.400 4.4e-17
lung cancer 3.000 4.5e-05
lung carcinoma -1.400 2.4e-09
Multiple myeloma 1.511 1.2e-02
non-small cell lung carcinoma -1.200 5.8e-21
pancreatic cancer 1.300 8.6e-04
pancreatic carcinoma 1.300 8.6e-04
periodontitis 1.200 3.0e-24
posterior fossa group B ependymoma 1.100 3.5e-05

Gene RIF (95)

AA Sequence

MPGLGRRAQWLCWWWGLLCSCCGPPPLRPPLPAAAAAAAGGQLLGDGGSPGRTEQPPPSPQSSSGFLYRR      1 - 70
LKTQEKREMQKEILSVLGLPHRPRPLHGLQQPQPPALRQQEEQQQQQQLPRGEPPPGRLKSAPLFMLDLY     71 - 140
NALSADNDEDGASEGERQQSWPHEAASSSQRRQPPPGAAHPLNRKSLLAPGSGSGGASPLTSAQDSAFLN    141 - 210
DADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIPEGEVVTAAEFRIYKDCVMGSFKNQTFLISIYQVL    211 - 280
QEHQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGVHVHPRAAGLVGRD    281 - 350
GPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVS    351 - 420
FQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLY    421 - 490
FDDNSNVILKKYRNMVVRACGCH                                                   491 - 513
//

Text Mined References (126)

PMID Year Title