Property Summary

NCBI Gene PubMed Count 37
Grant Count 38
R01 Count 25
Funding $4,090,374.69
PubMed Score 72.58
PubTator Score 36.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 2.500 0.000
posterior fossa group A ependymoma 3.900 0.000
non-small cell lung cancer -2.161 0.000
lung cancer -2.600 0.000
colon cancer -3.100 0.000
interstitial cystitis -2.800 0.000
lung adenocarcinoma -1.800 0.000
adult high grade glioma 1.400 0.000
sonic hedgehog group medulloblastoma 1.600 0.007
Breast cancer -1.800 0.000
lung carcinoma -3.100 0.000

Gene RIF (20)

PMID Text
25994008 findings suggested that BMP5 might be a potential prognostic biomarker or therapeutic target for patients with NSCLC
25030405 Our results showed that ASPN rs13301537 T to C change and variant C genotype may contribute to knee OA risk in a Chinese Han population.
24551273 BMP5, is elevated in the stenotic colon segment of Hirschsprung disease patients, and BMP5 signaling may play a pivotal role in disease development.
24384427 BMP5 and BMP7, involved in cardiomyocyte differentiation defect
23186552 Data indicate significant association between the bone morphogenetic protein 5 (BMP5) microsatellite and knee osteoarthritis (OA) in women, but not in men.
22844442 CASP3 rs4862396, BMP5 rs3734444 and IRS2 rs7986346 may affect the survival in patients after androgen-deprivation therapy for prostate cancer
21704030 Taken together, BMP4 and BMP5 simultaneously inhibit the growth and promote migration and invasion of the same pancreatic cells and thus exhibit a biphasic role with both detrimental and beneficial functions in pancreatic cancer progression
21319131 BMP-5 is expressed in the tubuli of adult kidneys. Its decreased expression in nephrosclerosis along with its regenerative capabilities in HK-2 cells may point to a protective role in hypertensive nephrosclerosis.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MHLTVFLLKGIVGFLWSCWVLVGYAKGGLGDNHVHSSFIYRRLRNHERREIQREILSILGLPHRPRPFSP      1 - 70
GKQASSAPLFMLDLYNAMTNEENPEESEYSVRASLAEETRGARKGYPASPNGYPRRIQLSRTTPLTTQSP     71 - 140
PLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEFRFDLTQIPHGEAVTAAEFRIYKDRSNNRFE    141 - 210
NETIKISIYQIIKEYTNRDADLFLLDTRKAQALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRS    211 - 280
INVKSAGLVGRQGPQSKQPFMVAFFKASEVLLRSVRAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQK    281 - 350
QACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCA    351 - 420
PTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH                                        421 - 454
//

Text Mined References (38)

PMID Year Title
25994008 2015 Differential expression of bone morphogenetic protein 5 in human lung squamous cell carcinoma and adenocarcinoma.
25401122 2014 Bone Morphogenetic Protein (BMP) signaling in development and human diseases.
25030405 2014 Association between single nucleotide polymorphisms of asporin (ASPN) and BMP5 with the risk of knee osteoarthritis in a Chinese Han population.
24551273 2014 Expression analysis of BMP2, BMP5, BMP10 in human colon tissues from Hirschsprung disease patients.
24384427 2014 Genome-wide study reveals an important role of spontaneous autoimmunity, cardiomyocyte differentiation defect and anti-angiogenic activities in gender-specific gene expression in Keshan disease.
23186552 2012 Association of a BMP5 microsatellite with knee osteoarthritis: case-control study.
22844442 2012 Genetic variants in CASP3, BMP5, and IRS2 genes may influence survival in prostate cancer patients receiving androgen-deprivation therapy.
21704030 2011 Bone morphogenetic protein -4 and -5 in pancreatic cancer--novel bidirectional players.
21319131 The role of bone morphogenetic protein-5 (BMP-5) in human nephrosclerosis.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
More...