Property Summary

NCBI Gene PubMed Count 89
Grant Count 157
R01 Count 109
Funding $19,374,791.96
PubMed Score 493.04
PubTator Score 335.91

Knowledge Summary

Patent (22,273)

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer -3.800 0.000
interstitial cystitis 1.600 0.001
lung carcinoma -2.100 0.000
pituitary cancer 1.300 0.006

Synonym

Accession P22001 Q5VWN2
Symbols MK3
HGK5
HLK3
PCN3
HPCN3
KV1.3
HUKIII

Gene

PDB

4BGC  

Gene RIF (80)

PMID Text
26748289 concluded that Kv1.3 may stimulate macrophage migration through the activation of ERK.
26655221 Data suggest that C-terminus is necessary for Kv1.3-induced cell proliferation; the mechanism involves accessibility of key docking sites at the C terminus; phosphorylation of Tyr-447 by MAP kinase signal cascade appears crucial.
26393354 Results contribute to the characterization of leukemic B cells, as it shows that upregulation of Kv1.3 in pathologic B lymphocytes is linked to the oncogenic B-RAF signaling.
26156069 the association between Kv1.3 and the COPII cargo adaptor subunit isoform Sec24a
26148969 Findings reveal that alpha-defensins are endogenous inhibitors of potassium voltage-gated channel subfamily A member 3 (Kv1.3) with distinct interaction mechanisms.
25944908 The increment and decrement of the basic residue number in a positively charged S4 sensor of Kv1.3 channel yields conductance-voltage relationship curves in the positive direction by approximately 31.2 mV and 2-4 mV
25829491 These results demonstrate that Kv1.3 channels are primarily localized in the nucleus of several types of cancer cells and human brain tissues where they are capable of regulating nuclear membrane potential and activation of transcription factors
25739456 actin dynamics regulates the membrane motility of Kv1.3 channels.
25688010 The inhibition of Kv1.3 channels might be involved in antiproliferative and proapoptotic effects of the compounds observed in cancer cell lines expressing these channels.
25644777 JAK2 participates in the signalling, regulating the voltage-gated K(+) channel KCNA3.
More...

AA Sequence

MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDHLLEPEVADGG      1 - 70
GAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYF     71 - 140
DPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERP    141 - 210
LPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNS    211 - 280
TSGSRAGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAER    281 - 350
QGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE    351 - 420
ADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE    421 - 490
TEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNN    491 - 560
NPNSCVNIKKIFTDV                                                           561 - 575
//

Text Mined References (90)

PMID Year Title
26748289 2016 Kv1.3 potassium channel mediates macrophage migration in atherosclerosis by regulating ERK activity.
26655221 2016 Molecular Determinants of Kv1.3 Potassium Channels-induced Proliferation.
26393354 2015 Biophysical characterization and expression analysis of Kv1.3 potassium channel in primary human leukemic B cells.
26156069 2015 Kv1.3 contains an alternative C-terminal ER exit motif and is recruited into COPII vesicles by Sec24a.
26148969 2015 Human ?-defensins are immune-related Kv1.3 channel inhibitors: new support for their roles in adaptive immunity.
25944908 2015 Kv Channel S1-S2 Linker Working as a Binding Site of Human ?-Defensin 2 for Channel Activation Modulation.
25829491 2015 Nuclear localization and functional characteristics of voltage-gated potassium channel Kv1.3.
25739456 2015 The C-terminus SH3-binding domain of Kv1.3 is required for the actin-mediated immobilization of the channel via cortactin.
25688010 2015 Inhibition of Kv1.3 Channels in Human Jurkat T Cells by Xanthohumol and Isoxanthohumol.
25644777 2015 Up-regulation of Kv1.3 channels by janus kinase 2.
More...