Property Summary

Ligand Count 226
NCBI Gene PubMed Count 94
PubMed Score 522.19
PubTator Score 335.91

Knowledge Summary

Patent (22,273)

TINX Plot

  Disease (5)

Disease Target Count P-value
lung carcinoma 2843 1.1e-17
lung cancer 4740 5.3e-03
pituitary cancer 1972 6.0e-03
interstitial cystitis 2312 6.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Panic disorder 61 0.0 1.7
Disease Target Count Z-score Confidence
psoriasis 6694 3.155 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
interstitial cystitis 1.400 6.7e-03
lung cancer -1.600 5.3e-03
lung carcinoma -2.100 1.1e-17
pituitary cancer 1.300 6.0e-03

Gene RIF (84)

AA Sequence

MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDHLLEPEVADGG      1 - 70
GAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYF     71 - 140
DPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERP    141 - 210
LPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNS    211 - 280
TSGSRAGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAER    281 - 350
QGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE    351 - 420
ADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE    421 - 490
TEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNN    491 - 560
NPNSCVNIKKIFTDV                                                           561 - 575
//

Text Mined References (95)

PMID Year Title