Property Summary

NCBI Gene PubMed Count 330
Grant Count 238
R01 Count 141
Funding $22,893,566.26
PubMed Score 1478.32
PubTator Score 1720.06

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P21980 E1P5V9 Q16436 Q6B838 Q9BTN7 Q9UH35
Symbols TGC
TG(C)

Gene

PANTHER Protein Class (2)

PDB

1FAU   1KV3   2Q3Z   3LY6   3S3J   3S3P   3S3S   4PYG  

Gene RIF (287)

PMID Text
26702927 PKM2/TG2 interplay plays an important role in the regulation of autophagy in particular under cellular stressful conditions such as those displayed by cancer cells.
26542019 A gain-of-function mutation in P2X7R associated with autoimmune disease caused enhanced TG2 externalization from cells, and this correlated with increased pore activity.
26307914 Results show no genetic association of the TGM2 gene with schizophrenia in the Chinese cohort.
26250429 W332F mutation led to significant changes of both the Km and the Vmax kinetic parameters of the isopeptidase reaction of TG2 while its calcium and GTP sensitivity was similar to the wild-type enzyme.
26244572 Data show that transglutaminase 2 (TG2)-mediated self-crosslinking sites locate to the catalytic core and C-terminal part of TG2.
26184652 The differences in epitope specificity and subclass usage of IgG anti-tTG observed between celiac disease (CD) and non-CD individuals may be due to the differing mechanisms underlying tTG autoimmunity.
26160175 This work presents a study on the interaction between TG2 and an anti-TG2 antibody (679-14-E06) derived from a single gut IgA plasma cell of a celiac disease patient.
26153762 The frequency of TG2-specific plasma cells in the celiac lesion is dynamically regulated in response to gluten exposure.
26133787 We showed the appearance of transglutaminase (TG2) immunoreactivity in leukocytes in multiple sclerosis lesions, and particular in macrophages in rat chronic-relapsing experimental autoimmune encephalomyelitis.
26133738 Transglutaminase 2 up-regulation is associated with RANKL/OPG pathway
More...

AA Sequence

MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQE      1 - 70
AGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLFN     71 - 140
AWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNPKFLKNAGRD    141 - 210
CSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVF    211 - 280
AAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPG    281 - 350
YEGWQALDPTPQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL    351 - 420
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVGQSMNMGSDFD    421 - 490
VFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEKSVPLCILYEKYRDCLTESNL    491 - 560
IKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLQNPLPVALEGCTFTVEGAGLT    561 - 630
EEQKTVEIPDPVEAGEEVKVRMDLLPLHMGLHKLVVNFESDKLKAVKGFRNVIIGPA                 631 - 687
//

Text Mined References (335)

PMID Year Title
26702927 2015 The transglutaminase type 2 and pyruvate kinase isoenzyme M2 interplay in autophagy regulation.
26542019 2015 P2X7 receptor activation regulates rapid unconventional export of transglutaminase-2.
26307914 2015 Lack of genetic association of the TGM2 gene with schizophrenia in a Chinese population.
26250429 2016 Isopeptidase activity of human transglutaminase 2: disconnection from transamidation and characterization by kinetic parameters.
26244572 2015 Enhanced B-Cell Receptor Recognition of the Autoantigen Transglutaminase 2 by Efficient Catalytic Self-Multimerization.
26184652 2015 IgG anti-tTG responses in different autoimmune conditions differ in their epitope targets and subclass usage.
26160175 2015 Structural Basis for Antigen Recognition by Transglutaminase 2-specific Autoantibodies in Celiac Disease.
26153762 2016 Responsive population dynamics and wide seeding into the duodenal lamina propria of transglutaminase-2-specific plasma cells in celiac disease.
26133787 2015 Tissue Transglutaminase contributes to experimental multiple sclerosis pathogenesis and clinical outcome by promoting macrophage migration.
26133738 2015 Transglutaminase 2 up-regulation is associated with RANKL/OPG pathway in cultured HPDL cells and THP-1-differentiated macrophages.
More...