Property Summary

Ligand Count 50
NCBI Gene PubMed Count 1,684
PubMed Score 2976.11
PubTator Score 3771.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Attention deficit hyperactivity disorder 278
Major Depressive Disorder 301
22q11 Deletion Syndrome 10
22q11 partial monosomy syndrome 9
Abnormality of aortic arch 9
Abnormality of pulmonary valve 23
Abnormality of the pharynx 19
Abnormality of the tonsils 10
Acne 52
Affective Disorders, Psychotic 6
Alcoholic Intoxication, Chronic 289
Anhedonia 27
Animal Mammary Neoplasms 136
Arachnodactyly 49
Atrial Septal Defects 85
Blepharoptosis 231
Broad flat nasal bridge 236
Bulbous nasal tip 48
Bulbous nose 48
CONOTRUNCAL ANOMALY FACE SYNDROME 9
Cannabis use 6
Chronic otitis media 52
Cleft Palate 271
Cocaine Dependence 51
Cognitive delay 608
Conductive hearing loss 123
Congenital Epicanthus 177
Congenital hypoplasia of kidney 32
Congenital hypoplasia of thymus 15
Constipation 181
Convex nasal bridge 57
Corneal Neovascularization 13
Dental caries 164
Depression, Bipolar 12
Depressive Syndrome 1
Depressive disorder 409
Drug-induced paranoid state 5
Dyschezia 135
Dysphasia 23
Dysphoric mood 7
Dysseborrheic dermatitis 13
Embryotoxon 28
Global developmental delay 608
Hypernasal voice 39
Hypocalcemia 32
Hypoparathyroidism 41
Hypoplastic lobules 11
Hypotrophic malar bone 129
Immunologic Deficiency Syndromes 113
Impaired T cell function 14
Liver carcinoma 240
Long face 71
Long philtrum 137
Low set ears 181
Malar flattening 129
Mammary Neoplasms 425
Marijuana Abuse 31
Mental Depression 333
Mental and motor retardation 608
Mild Mental Retardation 70
Mood Disorders 184
Muscle hypotonia 571
Myalgia 54
Nasal bridge wide 236
Nasal voice 39
Occipital myelomeningocele 8
Overfolded helix 24
Persistant truncus arteriosus 17
Platybasia 13
Posterior embryotoxon 28
Potato nose 48
Prominent nasal bridge 57
Rotting teeth 73
Seborrheic dermatitis 31
Short neck 140
Short stature 531
Shprintzen syndrome 9
Small thymus 13
Specific learning disability 47
Telecanthus 62
Tetany 18
Tetralogy of Fallot 67
Unipolar Depression 250
Upward slant of palpebral fissure 75
Uranostaphyloschisis 167
Ventricular Septal Defects 119
ear infection chronic 52
Disease Target Count P-value
ependymoma 4679 1.1e-09
tuberculosis 2010 2.3e-09
malignant mesothelioma 3232 8.8e-07
ovarian cancer 8520 1.7e-04

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.100 1.1e-09
malignant mesothelioma 1.400 8.8e-07
ovarian cancer -1.300 1.7e-04
tuberculosis 1.900 2.3e-09

Gene RIF (2038)

AA Sequence

MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPG      1 - 70
NAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIE     71 - 140
INPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLL    141 - 210
RKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP             211 - 271
//

Text Mined References (1690)

PMID Year Title