Property Summary

NCBI Gene PubMed Count 1,572
Grant Count 668
R01 Count 318
Funding $122,577,760.67
PubMed Score 2841.15
PubTator Score 3771.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (51)

Disease Z-score Confidence
Schizophrenia 501 6.686 3.3
Parkinson's disease 364 6.368 3.2
Attention deficit hyperactivity disorder 156 5.735 2.9
Velocardiofacial syndrome 45 5.586 2.8
Bipolar Disorder 266 5.22 2.6
obsessive-compulsive disorder 34 4.989 2.5
Panic disorder 55 4.599 2.3
Major Depressive Disorder 106 4.583 2.3
Conduct disorder 25 4.153 2.1
Alcohol dependence 107 3.941 2.0
Cancer 2,346 3.938 2.0
Schizoaffective disorder 33 3.922 2.0
Fibromyalgia 22 3.831 1.9
Nicotine dependence 53 3.655 1.8
Eating disorder 24 3.644 1.8
Personality disorder 25 3.467 1.7
Neonatal abstinence syndrome 9 3.409 1.7
Pain agnosia 99 3.365 1.7
Substance abuse 55 3.341 1.7
Dementia 129 3.323 1.7
Heroin dependence 30 3.285 1.6
Agoraphobia 16 3.245 1.6
Gilles de la Tourette syndrome 47 3.205 1.6
post-traumatic stress disorder 45 3.203 1.6
Specific phobia 7 3.091 1.5
Hypertension 287 3.066 1.5
22q11 Deletion Syndrome 7
22q11 partial monosomy syndrome 6
Alcoholic Intoxication, Chronic 41
Amphetamine-Related Disorders 74
Animal Mammary Neoplasms 136
Autistic Disorder 320
Biliary dyskinesia 7
CONOTRUNCAL ANOMALY FACE SYNDROME 6
Calculus in biliary tract 2
Cocaine-Related Disorders 88
Cognition Disorders 23
DiGeorge syndrome 46
Fetal Growth Retardation 9
HEARING LOSS, CISPLATIN-INDUCED, SUSCEPT... 3 
Liver carcinoma 217
Mammary Neoplasms 410
Mental disorders 11
Pain 70
Pheochromocytoma 22
Prostatic Neoplasms 471
Shprintzen syndrome 6
ependymoma 2,514
malignant mesothelioma 3,162
ovarian cancer 8,484
tuberculosis 1,557

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
ependymoma 1.100 0.000
tuberculosis 1.900 0.000
ovarian cancer 1.400 0.005

Synonym

Accession P21964 A8MPV9 Q6IB07 Q6ICE6 Q9BWC7
Symbols HEL-S-98n

Gene

PANTHER Protein Class (2)

PDB

3A7E   3BWM   3BWY   4PYI   4PYJ   4PYK   4XUC   4XUD   4XUE   5LSA  

Gene RIF (1926)

PMID Text
27074016 The AA genotype and the A allele of rs4680 (COMT) appeared to be inversely associated with the risk of prostate cancer in adjusted models for both Afro-Caribbean and native African men
27039372 Linear Regression showed COMT rs5993883 GG genotype predicted lower verbal learning (p = 0.0006) and memory (p = 0.0026) scores, and lower scores on a cognitive control(p = 0.004) in second generation antipsychotics treated pts. with bipolar disorder.
26986136 no association of rs4680 with post-traumatic stress disorder [meta-analysis]
26823844 COMT Val158Met polymorphism may have more impact on the modulation of blood pressure and lipid profiles in the average families than in the long-lived families in Bama region.
26818509 Prefrontal function was indexed by a polymorphism in the COMT gene, differences of which reflect dopamine levels in the prefrontal cortex
26810551 our updated meta-analysis suggested that COMT Val158Met polymorphism could decrease the risk of Alzheimer disease in the Asian population, but not in the Caucasian or the overall population.
26808641 rs1800497 and rs4633 play important roles in the anorexia nervosa (AN) susceptibility with respect to the Chinese Han population. The gene-gene interaction between DRD2 and COMT contributes to the risk of AN.
26798414 the association of CYP1A1 M1 (rs4646903) and COMT (rs4680) polymorphisms in 130 cervical cancer cases (c-cancer) and 179 controls, is reported.
26782546 No significant differences are found in the COMT gene polymorphism genotype distributions between cervical cancer patient and control groups.
26687156 COMT polymorphisms influence obsessive-compulsive patients' features.
More...

AA Sequence

MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPG      1 - 70
NAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIE     71 - 140
INPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLL    141 - 210
RKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP             211 - 271
//

Text Mined References (1578)

PMID Year Title
27074016 2016 Polymorphisms of Estrogen Metabolism-Related Genes and Prostate Cancer Risk in Two Populations of African Ancestry.
27039372 2016 Interaction between COMT rs5993883 and second generation antipsychotics is linked to decreases in verbal cognition and cognitive control in bipolar disorder.
26986136 2016 The Association Between Genetic Variants in the Dopaminergic System and Posttraumatic Stress Disorder: A Meta-Analysis.
26823844 2015 COMT Val158Met polymorphism is associated with blood pressure and lipid levels in general families of Bama longevous area in China.
26818509 2016 Variability in Dopamine Genes Dissociates Model-Based and Model-Free Reinforcement Learning.
26810551 2016 Association between polymorphism of COMT gene (Val158Met) with Alzheimer's disease: An updated analysis.
26808641 2016 Dopamine receptor D2 and catechol-O-methyltransferase gene polymorphisms associated with anorexia nervosa in Chinese Han population: DRD2 and COMT gene polymorphisms were associated with AN.
26798414 2016 Epistatic Interaction of CYP1A1 and COMT Polymorphisms in Cervical Cancer.
26782546 2015 Analysis of CYP1A1 and COMT polymorphisms in women with cervical cancer.
26687156 2016 Catechol-O-Methyltransferase Gene Polymorphisms in Specific Obsessive-Compulsive Disorder Patients' Subgroups.
More...