Property Summary

NCBI Gene PubMed Count 36
PubMed Score 27.62
PubTator Score 206.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Maple syrup urine disease 24 7.743 3.9
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
Crohn's disease 321 0.0 0.8

Expression

  Differential Expression (14)

Disease log2 FC p
Atopic dermatitis -1.100 1.6e-03
atypical teratoid / rhabdoid tumor 1.900 3.4e-07
ependymoma 2.100 1.5e-12
glioblastoma 1.200 1.4e-05
interstitial cystitis -1.200 1.7e-05
lung cancer -1.200 1.8e-02
lung carcinoma 1.200 2.4e-17
malignant mesothelioma -1.500 7.5e-07
medulloblastoma 1.100 3.3e-04
medulloblastoma, large-cell 1.200 2.3e-03
osteosarcoma 1.543 2.4e-04
pancreatic ductal adenocarcinoma liver m... -1.410 7.1e-03
psoriasis -1.100 1.5e-04
tuberculosis 2.700 4.2e-09

Protein-protein Interaction (3)

Gene RIF (17)

AA Sequence

MAVVAAAAGWLLRLRAAGAEGHWRRLPGAGLARGFLHPAATVEDAAQRRQVAHFTFQPDPEPREYGQTQK      1 - 70
MNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTG     71 - 140
ATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGI    141 - 210
KVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQ    211 - 280
VHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECF    281 - 350
LNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY                                351 - 392
//

Text Mined References (40)

PMID Year Title