Property Summary

NCBI Gene PubMed Count 170
Grant Count 128
R01 Count 86
Funding $11,680,212.78
PubMed Score 768.80
PubTator Score 422.97

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P21926 D3DUQ9 Q5J7W6 Q96ES4
Symbols MIC3
MRP-1
BTCC-1
DRAP-27
TSPAN29
TSPAN-29

Gene

CD9

Gene RIF (132)

PMID Text
26855131 Collectively, using tetraspanin CD9 in tandem with E-cadherin as a biomarker in renal cell carcinoma will help to not only distinguish between types, but also predict the metastatic potential of RCC.
26573230 Data suggest that CD9 should be further evaluated as a target for glioblastoma treatment.
26378766 CD9-enriched microdomains negatively regulate LPS-induced receptor formation by preventing CD14 from accumulating into lipid rafts. [Review]
26320102 High CD9 is associated with B acute lymphoblastic leukemia.
26275786 Low levels of CD9 coincidental with a novel nonsense mutation in glycoprotein Ibbeta in a patient with Bernard-Soulier syndrome.
26045817 CD9 expression is upregulated and its expression is correlated with tumor stage and lymph node metastasis in esophageal squamous cell carcinoma patients
26003300 The mechanism responsible for this negative regulation exerted by CD9 on LFA-1 adhesion does not involve changes in the affinity state of this integrin but seems to be related to alterations in its state of aggregation.
25955689 Results indicate that CD9 downregulation promoted pancreatic cancer cell proliferation and migration through at least in part, enhancing the cell surface expression of EGFR.
25840601 CD9 plays a role in the dysmegakaryopoiesis that occurs in primary myelofibrosis.
25762645 Data indicate that CD9 is implicated in BCC invasiveness and metastases by cellular mechanisms that involve specific CD9+ plasma membrane protrusions of BCCs.
More...

AA Sequence

MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALM      1 - 70
MLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQR     71 - 140
ETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFG    141 - 210
MIFSMILCCAIRRNREMV                                                        211 - 228
//

Text Mined References (172)

PMID Year Title
26855131 2016 The utility of tetraspanin CD9 as a biomarker for metastatic clear cell renal cell carcinoma.
26573230 2016 Transmembrane protein CD9 is glioblastoma biomarker, relevant for maintenance of glioblastoma stem cells.
26378766 2015 Preventive Role of Tetraspanin CD9 in Systemic Inflammation of Chronic Obstructive Pulmonary Disease.
26320102 2015 CD9, a key actor in the dissemination of lymphoblastic leukemia, modulating CXCR4-mediated migration via RAC1 signaling.
26275786 2015 Low levels of CD9 coincidental with a novel nonsense mutation in glycoprotein Ib? in a patient with Bernard-Soulier syndrome.
26045817 2015 Overexpression of CD9 correlates with tumor stage and lymph node metastasis in esophageal squamous cell carcinoma.
26003300 2015 Different states of integrin LFA-1 aggregation are controlled through its association with tetraspanin CD9.
25955689 2015 Downregulation of CD9 promotes pancreatic cancer growth and metastasis through upregulation of epidermal growth factor on the cell surface.
25840601 2015 Tetraspanin CD9 participates in dysmegakaryopoiesis and stromal interactions in primary myelofibrosis.
25762645 2015 Tetraspanin CD9 determines invasiveness and tumorigenicity of human breast cancer cells.
More...