Property Summary

NCBI Gene PubMed Count 107
Grant Count 70
R01 Count 43
Funding $11,734,017.89
PubMed Score 171.50
PubTator Score 136.59

Knowledge Summary

Patent (4,072)

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 0.002
gastric carcinoma -2.400 0.030

Synonym

Accession P21918 B2R9S3 Q8NEQ8
Symbols DBDR
DRD1B
DRD1L2

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
857 confirmatory 100 / 0 / 357 Allosteric Modulators of D1 Receptors: Dose-dependent Counterscreen
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
743374 confirmatory 0 / 0 / 2 Counterscreening of D4 Antagonists against Dopamine 5 DRD5 (Human), Confirmatory Assay

Gene RIF (88)

PMID Text
26186971 Conserved residues in intracellular loop 1 and transmembrane region 2 of DRD1 and DRD5 are essential in ligand binding and signal transduction.
25840828 This study shown DRD5 to be the risk factor for attention deficit/hyperactivity disorder.
25468276 This study demonistrated that Lymphocyte DR D5 is reduced in MS and IFN-beta restores their expression and responsiveness.
25154512 Constitutive D5R signalling up-regulated expression of Na,K-ATPase-alpha2 and NHE-2, increasing glucose metabolism. Agonist treatment increased this and also upregulated NHE-3.
25049074 LRs are essential not only for the proper membrane distribution and maintenance of AC5/6 activity but also for the regulation of D1R- and D5R-mediated AC signaling.
24668635 Our find-ings suggest that common genetic variations of DRD5 are likely to con-tribute to genetic susceptibility to paranoid schizophrenia in Han Chinese
24630741 We found significant negative correlations regarding the expression of the genes COMT, MAOB, DRD4, DRD5 and FOS, indicating that increased schizotypy coincides with higher levels of dopaminergic dysregulation on the mRNA-level.
24552847 D1R and D5R colocalize in renal proximal tubule cells and physically interact in second messenger coupling pathways and heterologous receptor interaction between the two receptors.
23445730 Its signaling regulates human osteoclastogenesis. (review)
23318175 in this report, the specific amino acids in the cytoplasmic regions of D5 and D2 receptors involved in heteromer interactions were determined.
More...

AA Sequence

MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVLVCAAIVRSRH      1 - 70
LRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFDIMCSTASILNLCVISVDRYW     71 - 140
AISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNWHRDQAASWGGLDLPNNLANWTPWEEDFWEP    141 - 210
DVNAENCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAP    211 - 280
DTSLRASIKKETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWA    281 - 350
NSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP    351 - 420
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH                 421 - 477
//

Text Mined References (108)

PMID Year Title
26186971 2015 Functional importance of two conserved residues in intracellular loop 1 and transmembrane region 2 of Family A GPCRs: insights from ligand binding and signal transduction responses of D1 and D5 dopaminergic receptor mutants.
25840828 2015 Multiple epigenetic factors predict the attention deficit/hyperactivity disorder among the Chinese Han children.
25468276 2014 Levels of mRNA for dopaminergic receptor D? in circulating lymphocytes may be associated with subsequent response to interferon-? in patients with multiple sclerosis.
25154512 2014 Agonist-dependent and -independent dopamine-1-like receptor signalling differentially regulates downstream effectors.
25049074 2014 Differential dopamine receptor subtype regulation of adenylyl cyclases in lipid rafts in human embryonic kidney and renal proximal tubule cells.
24668635 2014 Relationship between genetic polymorphisms in the DRD5 gene and paranoid schizophrenia in northern Han Chinese.
24630741 2014 Psychosis-proneness correlates with expression levels of dopaminergic genes.
24552847 2014 The cooperative roles of the dopamine receptors, D1R and D5R, on the regulation of renal sodium transport.
23445730 2013 [Dopamine receptor signaling regulates human osteoclastogenesis].
23318175 2013 D5 dopamine receptor carboxyl tail involved in D5-D2 heteromer formation.
More...