Property Summary

NCBI Gene PubMed Count 603
Grant Count 278
R01 Count 128
Funding $39,501,903.81
PubMed Score 707.09
PubTator Score 1219.26

Knowledge Summary

Patent (10,275)

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.008
psoriasis -1.500 0.000

Synonym

Accession P21917 B0M0J7 Q7Z7Q5 Q8NGM5
Symbols D4DR

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs

Gene RIF (740)

PMID Text
26688118 present findings suggest that DRD4L may be involved in the development of an intermediate phenotype specific to substance abuse.
26680992 findings thus reveal unreported structural determinants of the mutated DRD4 receptor and provide a robust framework for design of effective novel drugs.
26665568 The observed frequency of dopamine DRD1 and DRD4 polymorphisms is similar to the distribution of these variants in other Caucasian populations
26449981 DRD4 48 bp VNTR polymorphism was not associated with nicotine craving in adolescent novice smokers.
26439067 DRD4 and a two-way interaction of birth weight and 6-month maternal attention and sensitivity predicted disorganized attachment.
26427473 Data show that six antibodies raised against DRD4 peptides were tested for immunoblot and immunohistochemistry applications.
26424426 Study demonstrated a moderating role for regulatory problems and DRD4 genotype in predicting the Child Behavior Checklist-dysregulation profile from maternal responsiveness
26307064 A total of 267 HIV-infected adults were genotyped for polymorphisms, DRD4 48 bp-variable number tandem repeat (VNTR), DRD2 rs6277 and ANKK1 rs1800497.
26246555 In a large sample of 1771 Han Chinese university students in Singapore, subjects with two copies of the 4-repeat allele (4R/4R) of the dopamine D4 receptor gene exon III repeat region were significantly more conservative.
26037358 Gender, age, education and the rs3758653 polymorphism of the DRD4 gene play an important role in cognitive functions in healthy adults.
More...

AA Sequence

MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVATERALQTPTN      1 - 70
SFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCTASIFNLCAISVDRFVAVAVP     71 - 140
LRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGRDPAVCRLEDRDYVVYSSVCSFFLPCPLMLL    141 - 210
LYWATFRGLQRWEVARRAKLHGRAPRRPSGPGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAP    211 - 280
AAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLP    281 - 350
PDPCGSNCAPPDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC    351 - 420
PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC                           421 - 467
//

Text Mined References (608)

PMID Year Title
26688118 2016 Dopamine D4 receptor VNTR polymorphism associated with greater risk for substance abuse among adolescents with disruptive behavior disorders: Preliminary results.
26680992 2016 Structural signatures of DRD4 mutants revealed using molecular dynamics simulations: Implications for drug targeting.
26665568 2015 DRD1 and DRD4 dopamine receptors in the etiology of preeclampsia.
26449981 2015 Parental smoke exposure and the development of nicotine craving in adolescent novice smokers: the roles of DRD2, DRD4, and OPRM1 genotypes.
26439067 2015 The interplay of birth weight, dopamine receptor D4 gene (DRD4), and early maternal care in the prediction of disorganized attachment at 36 months of age.
26427473 2016 Characterization of Antibodies to Identify Cellular Expression of Dopamine Receptor 4.
26424426 2015 Interacting effects of maternal responsiveness, infant regulatory problems and dopamine D4 receptor gene in the development of dysregulation during childhood: A longitudinal analysis.
26307064 2015 DRD2 and DRD4 genes related to cognitive deficits in HIV-infected adults who abuse alcohol.
26246555 2015 Association between the dopamine D4 receptor gene exon III variable number of tandem repeats and political attitudes in female Han Chinese.
26037358 2015 [Association of gender, age, education and polymorphism of DRD4 gene with cognitive functions in adults].
More...