Property Summary

Ligand Count 1,332
NCBI Gene PubMed Count 641
PubMed Score 745.02
PubTator Score 1219.26

Knowledge Summary

Patent (10,275)

TINX Plot

  Disease (7)

Disease Target Count P-value
psoriasis 6694 1.1e-17
atypical teratoid / rhabdoid tumor 5112 8.0e-03
Disease Target Count Z-score Confidence
Opiate dependence 29 0.0 5.0

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 8.0e-03
psoriasis -1.500 1.1e-17

Gene RIF (776)

AA Sequence

MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVATERALQTPTN      1 - 70
SFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCTASIFNLCAISVDRFVAVAVP     71 - 140
LRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGRDPAVCRLEDRDYVVYSSVCSFFLPCPLMLL    141 - 210
LYWATFRGLQRWEVARRAKLHGRAPRRPSGPGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAP    211 - 280
AAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLP    281 - 350
PDPCGSNCAPPDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC    351 - 420
PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC                           421 - 467
//

Text Mined References (646)

PMID Year Title