Property Summary

NCBI Gene PubMed Count 157
Grant Count 37
R01 Count 6
Funding $4,603,338.67
PubMed Score 424.45
PubTator Score 704.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (149)

PMID Text
26749241 that SDHAF1 contributes to iron-sulfur (Fe-S) cluster incorporation into the Fe-S subunit of CII, SDHB.
26719882 Findings provide a conceptual framework for understanding how particular mutations disproportionately cause the loss of SDH activity, resulting in accumulation of succinate and metabolic remodeling in SDHB cancer syndromes.
26642834 Succinate dehydrogenase deficiency is a rare leukoencephalopathy, for which improved recognition by magnetic resonance imaging (MRI) in combination with advanced sequencing technologies allows noninvasive diagnostic confirmation.
26457353 Report direct correlation between the presence of an SDHB mutation, whether germline or somatic, and negative SDHB immunohistochemical staining in bladder paragangliomas.
26259135 This study strengthens the etiological association of SDH genes with pituitary neoplasia, renal tumorigenesis, and gastric gastrointestinal stromal tumors. Also, pancreatic neuroendocrine tumor falls within the SDH-related tumor spectrum.
26113606 15 YEARS OF PARAGANGLIOMA: Genetics and mechanism of pheochromocytoma-paraganglioma syndromes characterized by germline SDHB and SDHD mutations
25972245 Study reveals new insights into the effects of SDHB mutations and the power of structural modelling in predicting biological consequences.
25827535 Succinate dehydrogenase B expression in clear cell papillary renal cell carcinoma with high nucleolar grade (G3-G4) is significantly associated with survival, indicating it may be both a diagnostic and prognostic marker in renal cell carcinoma
25827221 The low penetrance of SDHB mutations may obscure the hereditary nature of SDHB-linked disease and is important in the counseling of SDHB-linked patients.
25695889 Found an association between germline mutation of SDHB and a familial paraganglioma/pheochromocytoma plus pituitary adenoma.
More...

AA Sequence

MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGP      1 - 70
MVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLV     71 - 140
PDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPA    141 - 210
VLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV    211 - 280
//

Text Mined References (165)

PMID Year Title
26749241 2016 Disease-Causing SDHAF1 Mutations Impair Transfer of Fe-S Clusters to SDHB.
26719882 2016 SDHB-Deficient Cancers: The Role of Mutations That Impair Iron Sulfur Cluster Delivery.
26642834 2016 Magnetic resonance imaging spectrum of succinate dehydrogenase-related infantile leukoencephalopathy.
26457353 2015 Urinary Bladder Paragangliomas: How Immunohistochemistry Can Assist to Identify Patients With SDHB Germline and Somatic Mutations.
26259135 2015 Succinate Dehydrogenase (SDH)-Deficient Pancreatic Neuroendocrine Tumor Expands the SDH-Related Tumor Spectrum.
26113606 2015 15 YEARS OF PARAGANGLIOMA: Genetics and mechanism of pheochromocytoma-paraganglioma syndromes characterized by germline SDHB and SDHD mutations.
25972245 2015 Structural and functional consequences of succinate dehydrogenase subunit B mutations.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25827535 2015 Succinate dehydrogenase B: a new prognostic biomarker in clear cell renal cell carcinoma.
25827221 2016 Low penetrance of paraganglioma and pheochromocytoma in an extended kindred with a germline SDHB exon 3 deletion.
More...