Property Summary

NCBI Gene PubMed Count 180
PubMed Score 460.20
PubTator Score 704.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Renal Cell Carcinoma 214
Abdominal Pain 98
Abnormality of the penis 7
Adult onset 82
Anxiety (with pheochromocytoma) 3
Big calvaria 147
Birthmark 35
Brain hemorrhage 14
COWDEN-LIKE SYNDROME (disorder) 2
Cafe-au-Lait Spots 37
Carotid Body Paraganglioma 4
Cerebellar Ataxia 304
Cerebral Hemorrhage 42
Cognitive delay 608
Congenital Bilateral Cataracts 50
Congenital cataract 50
Congenital deafness 185
Congestive heart failure 113
Conjunctival hamartoma 7
Constipation 181
Cranial nerve palsies 11
Deafness 198
Deglutition Disorders 132
Dull intelligence 645
Dyschezia 135
Elevated heart rate 25
Elevated urinary norepinephrine 5
Endometrial carcinoma 15
Fatigue 182
Fibrous skin tumor of tuberous sclerosis 18
Fissured tongue 25
Gastrointestinal Hemorrhage 52
Gastrointestinal Neoplasms 7
Gastrointestinal hamartomatous polyps 10
Global developmental delay 608
Glomus Jugulare Tumor 4
Goiter 38
Hamartoma Syndrome, Multiple 10
Hamartomatous polyp 10
Headache (with pheochromocytoma) 3
Hearing Loss, Partial 185
Heart failure 162
Hemangioma 69
Hemangioma, Cavernous 20
Hypercalcemia 59
Hyperhidrosis disorder 81
Hyperkeratosis, generalized 14
Hyperpigmentation 37
Hypertension associated with pheochromocytoma 3
Hypertension, episodic 5
Hypertensive Retinopathy 14
Impaired cognition 96
Increased gastric cancer 21
Increased head circumference 147
Increased size of cranium 147
Increased size of skull 147
Increased sweating 81
Intellectual disability 1016
Intestinal Obstruction 31
Isolated cases 72
Large hand 18
Lipoma 32
Low intelligence 645
Macroglossia 65
Macule 19
Melanocytic nevus 43
Meningioma 41
Mental Retardation 645
Mental and motor retardation 608
Mental deficiency 645
Mental impairment 95
Mucosal telangiectasiae 14
Multiple, subcutaneous nodules 53
Nausea and vomiting 97
Neurofibromatoses 5
Noncancerous mole 28
Palmoplantar keratosis 74
Palpitations 18
Papillary thyroid carcinoma 43
Papilloma 44
Papule 43
Pheochromocytoma, Extra-Adrenal 2
Polyp of large intestine 8
Poor school performance 645
Positive regitine blocking test 5
Proteinuria 144
Pulsatile Tinnitus 1
Renal Artery Stenosis 9
Sarcoma 62
Sebaceous adenoma 26
Stomach Neoplasms 300
Subcutaneous nodule 53
Sweating 81
Tachycardia 43
Tinnitus 19
Urticaria 67
Uterine Fibroids 3
Weight decreased 103
breast carcinoma 1638
hearing impairment 199
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.400 1.7e-02
ovarian cancer 1.800 2.1e-04
pancreatic ductal adenocarcinoma liver m... -1.997 5.3e-03

Protein-protein Interaction (12)

Gene RIF (170)

AA Sequence

MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGP      1 - 70
MVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLV     71 - 140
PDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPA    141 - 210
VLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV    211 - 280
//

Text Mined References (188)

PMID Year Title