Property Summary

NCBI Gene PubMed Count 371
PubMed Score 814.44
PubTator Score 726.05

Knowledge Summary

Patent (263,248)

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
osteosarcoma 7933 2.33030524778387E-7
atypical teratoid/rhabdoid tumor 1095 9.68955663087626E-7
Duchenne muscular dystrophy 602 1.57202872186348E-6
cystic fibrosis 1670 1.05843984904699E-5
ulcerative colitis 2087 1.10633131069896E-5
interstitial cystitis 2299 5.2108497172701E-5
group 3 medulloblastoma 2254 1.67869787865057E-4
pancreatic cancer 2300 2.87402989092035E-4
pilocytic astrocytoma 3086 3.53030973293276E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.08628638966053E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.78714884775564E-4
Down syndrome 548 8.64968759372606E-4
pituitary cancer 1972 0.00101907690776526
lung adenocarcinoma 2714 0.0014333931855031
ovarian cancer 8492 0.00191316632023941
Pick disease 1893 0.00230604192222476
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0026275309252178
ductal carcinoma in situ 1745 0.00292433851332212
subependymal giant cell astrocytoma 2287 0.0124994162849941
cutaneous lupus erythematosus 1056 0.0134239422274274
pediatric high grade glioma 2712 0.0136629681620623
primary pancreatic ductal adenocarcinoma 1271 0.0157451544288532
medulloblastoma, large-cell 6234 0.0167929797901874
invasive ductal carcinoma 2950 0.0193464128193992
ependymoma 2514 0.0317389546693502
glioblastoma 5572 0.0325479316265299
progressive supranuclear palsy 674 0.0389860293212188
fibroadenoma 557 0.0426554363859278
Breast cancer 3099 0.0466620153946256
spina bifida 1064 0.0490545238378325
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Alopecia areata 37 0.0 2.0
Type 1 diabetes mellitus 104 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 5.963 3.0

Expression

Synonym

Accession P21860 A8K6L6 B4DIK7 B4DV32 E9PDT8 Q9BUD7
Symbols HER3
LCCS2
ErbB-3
c-erbB3
erbB3-S
MDA-BF-1
c-erbB-3
p180-ErbB3
p45-sErbB3
p85-sErbB3

Gene

PDB

4RIW   4RIX   4RIY   1M6B   2L9U   3KEX   3LMG   3P11   4LEO   4OTW   4P59   5CUS  

  Ortholog (9)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (292)

PMID Text
27070783 Expression and Prognostic Significance of Human Epidermal Growth Factor Receptors 1, 2 and 3 in Periampullary Adenocarcinoma
27069134 HER Family Protein Expression in a Greek Population with Gastric Cancer. A Retrospective Hellenic Cooperative Oncology Group Study
27035903 measurements comprising the receptors EGFR, ERBB3 (HER3), and the cyclin-dependent kinase inhibitor p27 (CDKN1B) was found to accurately predict dependence on PI3K/AKT vs. MAPK/ERK signaling axes in HER2+ cancers
26975582 Data indicate that clathrin-mediated endocytosis of proto-oncogene protein erbB-3 (ErbB3) is depending on epsin-1.
26963794 HPV 16 E2 can modulate ErbB-3 by interacting with Nrdp-1, which is involved in the regulation of this receptor, via ubiquitination and degradation.
26886748 while transcript and protein levels of EGFR and ErbB2 were up-regulated or unaffected, respectively, hepatitis c virus induced a substantial reduction of ErbB3 and ErbB4 expression.
26860947 We report that targeting HER3 and b1 integrin provides a particularly effective combination therapy approach for HER2-amplified cancers, surpassing the combination of HER2 and b1 integrin targeting, and evading some of the safety concerns associated with direct HER2-targeting.
26844548 High EGFR expression was an independent risk factor for shorter overall survival (OS), whereas high HER3 expression was associated with a borderline significant trend towards a longer OS.
26770651 NRF2 regulates both HER2 and HER3 receptors to influence cellular responses to HER2 targeting.
26719328 ErbB3 nuclear translocation is a common event in proliferating tissues.
More...

AA Sequence

MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGH      1 - 70
NADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLT     71 - 140
EILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTIC    141 - 210
APQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKY    211 - 280
QYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDG    281 - 350
FVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG    351 - 420
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPR    421 - 490
RDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPME    491 - 560
GTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCL    561 - 630
GQTLVLIGKTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVL    631 - 700
ARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAH    701 - 770
IVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV    771 - 840
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAE    841 - 910
PYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKR    911 - 980
ESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEEDNLATTTLGSALSLPVGTLNRPRGSQSLLSP    981 - 1050
SSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSR   1051 - 1120
SRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEE   1121 - 1190
EDEDEEYEYMNRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDY   1191 - 1260
EYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWH   1261 - 1330
SRLFPKANAQRT                                                             1331 - 1342
//

Text Mined References (378)

PMID Year Title
27070783 2016 Expression and Prognostic Significance of Human Epidermal Growth Factor Receptors 1, 2 and 3 in Periampullary Adenocarcinoma.
27069134 2016 HER Family Protein Expression in a Greek Population with Gastric Cancer. A Retrospective Hellenic Cooperative Oncology Group Study.
27035903 2016 HER2+ Cancer Cell Dependence on PI3K vs. MAPK Signaling Axes Is Determined by Expression of EGFR, ERBB3 and CDKN1B.
26975582 2016 Interaction with epsin 1 regulates the constitutive clathrin-dependent internalization of ErbB3.
26963794 2016 Human papillomavirus 16 E2 interacts with neuregulin receptor degradation protein 1 affecting ErbB-3 expression in vitro and in clinical samples of cervical lesions.
26886748 2016 Hepatitis C Virus Activates a Neuregulin-Driven Circuit to Modify Surface Expression of Growth Factor Receptors of the ErbB Family.
26860947 2016 Effective treatment of HER2-amplified breast cancer by targeting HER3 and ?1 integrin.
26844548 2016 Expression and Prognostic Significance of Human Epidermal Growth Factor Receptors 1 and 3 in Gastric and Esophageal Adenocarcinoma.
26770651 2016 NRF2 Regulates HER2 and HER3 Signaling Pathway to Modulate Sensitivity to Targeted Immunotherapies.
26719328 2016 Activated ErbB3 Translocates to the Nucleus via Clathrin-independent Endocytosis, Which Is Associated with Proliferating Cells.
More...