Property Summary

Ligand Count 7
NCBI Gene PubMed Count 407
PubMed Score 870.28
PubTator Score 726.05

Knowledge Summary

Patent (263,248)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
Kidney cancer 2613 0.0 1.0
Disease Target Count Z-score Confidence
Alopecia areata 41 0.0 3.0
Type 1 diabetes mellitus 109 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 6.017 3.0
Disease Target Count
Acute myeloid leukemia, M6 type 2

Expression

  Differential Expression (30)

Disease log2 FC p
Astrocytoma, Pilocytic 2.000 1.8e-04
atypical teratoid / rhabdoid tumor -2.400 2.8e-04
Breast cancer 2.400 2.9e-02
cutaneous lupus erythematosus -1.200 1.3e-02
cystic fibrosis -2.091 1.1e-05
Down syndrome 1.700 8.6e-04
Duchenne muscular dystrophy 1.265 1.6e-06
ductal carcinoma in situ 3.300 2.9e-03
ependymoma -2.700 3.2e-02
fibroadenoma 1.300 4.3e-02
glioblastoma -1.600 3.3e-02
group 3 medulloblastoma -3.400 3.6e-04
interstitial cystitis -1.700 1.5e-03
intraductal papillary-mucinous adenoma (... 1.400 1.0e-02
intraductal papillary-mucinous carcinoma... 2.000 1.8e-03
intraductal papillary-mucinous neoplasm ... 1.900 1.3e-02
invasive ductal carcinoma 3.200 1.9e-02
lung adenocarcinoma 1.138 1.4e-03
medulloblastoma, large-cell -1.900 1.7e-02
osteosarcoma 1.650 2.3e-07
ovarian cancer 1.800 1.9e-03
pancreatic cancer 1.100 1.1e-03
pediatric high grade glioma -1.700 1.4e-02
Pick disease -1.300 3.6e-02
pituitary cancer -1.100 1.0e-03
primary pancreatic ductal adenocarcinoma 1.275 1.6e-02
progressive supranuclear palsy -1.800 3.9e-02
spina bifida -1.971 4.9e-02
subependymal giant cell astrocytoma -3.041 1.1e-02
ulcerative colitis -1.300 2.9e-04

Protein-protein Interaction (7)

Gene RIF (324)

AA Sequence

MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGH      1 - 70
NADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLT     71 - 140
EILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTIC    141 - 210
APQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKY    211 - 280
QYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDG    281 - 350
FVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG    351 - 420
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPR    421 - 490
RDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPME    491 - 560
GTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCL    561 - 630
GQTLVLIGKTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVL    631 - 700
ARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAH    701 - 770
IVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV    771 - 840
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAE    841 - 910
PYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKR    911 - 980
ESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEEDNLATTTLGSALSLPVGTLNRPRGSQSLLSP    981 - 1050
SSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSR   1051 - 1120
SRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEE   1121 - 1190
EDEDEEYEYMNRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDY   1191 - 1260
EYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWH   1261 - 1330
SRLFPKANAQRT                                                             1331 - 1342
//

Text Mined References (414)

PMID Year Title