Property Summary

NCBI Gene PubMed Count 29
Grant Count 39
R01 Count 26
Funding $2,389,950.09
PubMed Score 64.59
PubTator Score 57.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.835 0.000
interstitial cystitis 2.400 0.009
nasopharyngeal carcinoma -1.300 0.002
invasive ductal carcinoma 1.300 0.003
ulcerative colitis 1.300 0.044
head and neck cancer and chronic obstruc... 1.200 0.002

Gene RIF (17)

PMID Text
26883681 Increased soluble CD72 in systemic lupus erythematosus is in association with disease activity and lupus nephritis
24461079 CD72 expression on activated B cells of SLE patients was significantly lower than that of normal controls. sema3A enhanced CD72 expression of B cells, but it was still lower in SLE patients than in normal individuals.
23268649 regulates serum immunoglobulin leveln and disease resistance in systemic lupus erythematosus
23184497 data demonstrated aberrant expression of CD72 exists on B cells of myasthenia gravis and multiple sclerosis patients and expression level of CD72 molecule has a significantly negative correlation with anti-AchR antibody levels in myasthenia gravis
22606231 CD100, CD72 and CD45 were expressed in placenta and exhibited different mRNA and protein levels in normal pregnancy and miscarriage. Protein levels were highly dysregulated around 10 weeks of gestation in first and second miscarriage placentas.
22111667 CD72 mRNA expression level correlates with Sema4D expression in peripheral blood mononuclear cells in immune thrombocytopenia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20100931 Data show that ligation of CD72 with the BU40, or with rCD100 negatively regulates KIT-mediated mast cell proliferation, chemotaxis, and chemokine production.
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQP      1 - 70
TASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLR     71 - 140
QQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALE    141 - 210
QKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHS    211 - 280
YYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYIC    281 - 350
EMTAFRFPD                                                                 351 - 359
//

Text Mined References (29)

PMID Year Title
26883681 2016 Increased soluble CD72 in systemic lupus erythematosus is in association with disease activity and lupus nephritis.
24461079 2014 A regulatory role for CD72 expression on B cells in systemic lupus erythematosus.
23268649 2012 Human CD72 splicing isoform responsible for resistance to systemic lupus erythematosus regulates serum immunoglobulin level and is localized in endoplasmic reticulum.
23184497 2013 Modulation of B cell regulatory molecules CD22 and CD72 in myasthenia gravis and multiple sclerosis.
22606231 2012 Placental expression of CD100, CD72 and CD45 is dysregulated in human miscarriage.
22111667 2012 CD72 gene expression in immune thrombocytopenia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20100931 2010 CD72 negatively regulates KIT-mediated responses in human mast cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...