Property Summary

NCBI Gene PubMed Count 30
PubMed Score 67.35
PubTator Score 57.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
head and neck cancer and chronic obstruc... 1.200 2.1e-03
interstitial cystitis 2.400 8.9e-03
invasive ductal carcinoma 1.300 2.6e-03
nasopharyngeal carcinoma -1.300 2.1e-03
osteosarcoma -2.835 3.3e-07
ulcerative colitis 1.300 4.4e-02

Protein-protein Interaction (4)

Gene RIF (18)

AA Sequence

MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQP      1 - 70
TASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLR     71 - 140
QQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALE    141 - 210
QKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHS    211 - 280
YYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYIC    281 - 350
EMTAFRFPD                                                                 351 - 359
//

Text Mined References (30)

PMID Year Title