Property Summary

NCBI Gene PubMed Count 47
Grant Count 136
R01 Count 89
Funding $12,756,105.62
PubMed Score 722.99
PubTator Score 293.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma 2.800 0.018
posterior fossa group A ependymoma 3.300 0.000
atypical teratoid / rhabdoid tumor 2.000 0.007
pediatric high grade glioma 2.800 0.002
pilocytic astrocytoma 1.500 0.029
Breast cancer 1.400 0.000
ductal carcinoma in situ 1.400 0.041
invasive ductal carcinoma 1.300 0.037
ovarian cancer 1.100 0.019
psoriasis -1.600 0.000

Synonym

Accession P21815
Symbols BSP
BNSP
SP-II
BSP-II

Gene

Gene RIF (37)

PMID Text
26568273 Two significant SNPs within IBSP, rs1054627 and rs17013181, were associated with BMD and postmenopausal osteoporosis by the two-stage strategy, and rs17013181 was also significantly associated with serum IBSP levels.
26413977 Preameloblast-Derived Factors Mediate Osteoblast Differentiation of Human Bone Marrow Mesenchymal Stem Cells by Runx2-Osterix-BSP Signaling.
25973097 the strong correlation between bone sialoprotein and OPN and papillary thyroid carcinoma suggests a role for BSP and OPN in calcification and tumor progression of papillary thyroid carcinoma
25504218 oxidized low-density lipoprotein-induced expression dependent on Runx2 expression
24530278 Bone sialoprotein could be a key mediator of the hypertrophic chondrocytes-induced angiogenesis of osteoarthritis.
24071501 Current evidence demonstrates that BSP and OPN, play significant roles in bone metastasis of osteotropic malignancies derived from breast, prostate, lung, thyroid, and multiple myeloma. [review]
23726130 High expression of bone sialoprotein in breast neoplasms was associated with cytokeratin-positive cells in bone marrow, but not with lymph node metastasis.
23667544 BSP silencing decreased the integrin alphavbeta3 and beta3 levels, in turn inhibiting cell migration and invasion and decreasing the ability of the cells to metastasize to bone.
23485603 results indicate that FGF2 increases BSP transcription by targeting the FRE and AP1 elements in the proximal promoter of the human BSP gene.
23314561 IBSP mRNA is over expressed in carotid atheroma plaque (3.74 fold, p = 1.41E-09) in an intraindividual comparison.
More...

AA Sequence

MKTALILLSILGMACAFSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQGSSDSSEEN      1 - 70
GDDSSEEEEEEEETSNEGENNEESNEDEDSEAENTTLSATTLGYGEDATPGTGYTGLAAIQLPKKAGDIT     71 - 140
NKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGAN    141 - 210
AEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYES    211 - 280
ENGEPRGDNYRAYEDEYSYFKGQGYDGYDGQNYYHHQ                                     281 - 317
//

Text Mined References (49)

PMID Year Title
26568273 2015 Endochondral ossification pathway genes and postmenopausal osteoporosis: Association and specific allele related serum bone sialoprotein levels in Han Chinese.
26413977 2016 Preameloblast-Derived Factors Mediate Osteoblast Differentiation of Human Bone Marrow Mesenchymal Stem Cells by Runx2-Osterix-BSP Signaling.
25973097 2015 Correlation between calcification and bone sialoprotein and osteopontin in papillary thyroid carcinoma.
25504218 2015 Oxidized low-density lipoprotein increases bone sialoprotein expression in vascular smooth muscle cells via runt-related transcription factor 2.
24530278 2014 Bone sialoprotein as a potential key factor implicated in the pathophysiology of osteoarthritis.
24071501 2014 Bone sialoprotein and osteopontin in bone metastasis of osteotropic cancers.
23726130 2013 Patterns of metastatic spread in early breast cancer.
23667544 2013 BSP gene silencing inhibits migration, invasion, and bone metastasis of MDA-MB-231BO human breast cancer cells.
23485603 2013 Transcriptional regulation of the human bone sialoprotein gene by fibroblast growth factor 2.
23314561 2012 Microarray analysis reveals overexpression of IBSP in human carotid plaques.
More...