Property Summary

NCBI Gene PubMed Count 50
PubMed Score 756.83
PubTator Score 293.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 2.800 3.5e-04
Astrocytoma, Pilocytic 1.500 3.0e-02
atypical teratoid / rhabdoid tumor 2.000 7.2e-03
Breast cancer 1.400 2.7e-04
ductal carcinoma in situ 1.400 4.1e-02
ependymoma 2.300 2.2e-03
glioblastoma 2.700 1.1e-03
invasive ductal carcinoma 1.300 3.7e-02
ovarian cancer 1.100 1.9e-02
psoriasis -1.600 2.0e-07

 GWAS Trait (1)

Gene RIF (39)

AA Sequence

MKTALILLSILGMACAFSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQGSSDSSEEN      1 - 70
GDDSSEEEEEEEETSNEGENNEESNEDEDSEAENTTLSATTLGYGEDATPGTGYTGLAAIQLPKKAGDIT     71 - 140
NKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGAN    141 - 210
AEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYES    211 - 280
ENGEPRGDNYRAYEDEYSYFKGQGYDGYDGQNYYHHQ                                     281 - 317
//

Text Mined References (52)

PMID Year Title