Property Summary

NCBI Gene PubMed Count 487
PubMed Score 1138.65
PubTator Score 1106.77

Knowledge Summary

Patent (141,681)

TINX Plot

  Disease Sources (10)

Disease Target Count P-value
lung carcinoma 2844 9.18719896554375E-21
breast carcinoma 1614 1.40819190572121E-19
lung adenocarcinoma 2714 1.20206787419905E-13
lung cancer 4473 9.40472529217804E-8
oligodendroglioma 2849 3.73964772319043E-7
pilocytic astrocytoma 3086 4.42806670053256E-7
group 3 medulloblastoma 2254 4.81194456723844E-7
ulcerative colitis 2087 1.04861007485417E-6
colon cancer 1475 3.09445992253541E-5
Down syndrome 548 2.08011462789492E-4
glioblastoma 5572 2.61731659187247E-4
ovarian cancer 8492 4.32333610545429E-4
pediatric high grade glioma 2712 4.60889770013159E-4
subependymal giant cell astrocytoma 2287 0.00194087494709558
medulloblastoma, large-cell 6234 0.002085571716324
posterior fossa group A ependymoma 1511 0.00280268959335966
cutaneous lupus erythematosus 1056 0.00892648221204854
osteosarcoma 7933 0.0129552931056384
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0130369214579211
non primary Sjogren syndrome sicca 840 0.0175874342895481
adrenocortical carcinoma 1427 0.0233429533108417
atypical teratoid / rhabdoid tumor 4369 0.0260956739744416
aldosterone-producing adenoma 664 0.031544927468747
Hydrolethalus syndrome 128 0.0477421870616505
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Endometrial cancer 32 0.0 1.0
Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 2.0
Gout 93 0.0 1.0
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 5.134 2.6
Intellectual disability 573 0.0 4.0

Expression

  Differential Expression (25)

Gene

PDB

1NUN   1EV2   1II4   1IIL   2FDB   1DJS   1E0O   1GJO   1OEC   1WVZ   2PSQ   2PVF   2PVY   2PWL   2PY3   2PZ5   2PZP   2PZR   2Q0B   3B2T   3CAF   3CLY   3CU1   3DAR   3EUU   3OJ2   3OJM   3RI1   4J23   4J95   4J96   4J97   4J98   4J99   4WV1   5EG3  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

  TechDev Info (2)

Gary Johnson Kinome profile via MIB/MS Technology
Michael McManus Genetic interaction screen

 CSPA Cell Line (3)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (391)

PMID Text
26853422 Results suggest, a potential role for PIK3CA, VEGFR2, RET and FGFR2 as therapeutic targets in EGFR non-mutated NSCLC that requires further clinical validation.
26743380 The association of the FGFR2 gene with risk of overall and ER-positive breast cancer.
26728143 FGFR2 is a breast cancer susceptibility gene.
26687682 FGFR1/2 act in concert to recruit and transphosphorylate phospholipase Cgamma1.
26613250 this study shows preliminary evidence for the role of FGFR signaling in the proliferation and differentiation of Apert dental pulp and enamel organ epithelia cells.
26575424 Formononetin targets the FGFR2-mediated Akt signaling pathway, leading to the suppression of tumor growth and angiogenesis in breast neoplasms.
26574622 for the first time, report the molecular mechanisms by which AP24534 exerts antitumor effects on ECs with FGFR2 activating mutations, which would provide mechanistic insight into ongoing clinical investigations of AP24534 for ECs.
26551078 that STAT-5, RUNX-2, and FGFR-2 may have a role in the progression of the mucinous phenotype, in which nuclear STAT-5 may inhibit RUNX-2 prometastatic effect
26516773 intratumoral heterogeneity and discordant FGFR2b expression in primary tumors and metastatic lymph nodes are common in gastric cancer
26506517 High FGFR2 expression is associated with colorectal cancer.
More...

AA Sequence

MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVI      1 - 70
SWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGA     71 - 140
EDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVR    141 - 210
NQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKV    211 - 280
YSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGI    281 - 350
SFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTK    351 - 420
RIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEG    421 - 490
CFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPL    491 - 560
YVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAAR    561 - 630
NVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLG    631 - 700
GSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYL    701 - 770
DLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT                       771 - 821
//

Text Mined References (505)

PMID Year Title
26853422 Genomic profiling in a homogeneous molecular subtype of non-small cell lung cancer: An effort to explore new drug targets.
26743380 2016 Gene-based analysis of the fibroblast growth factor receptor signaling pathway in relation to breast cancer in African American women: the AMBER consortium.
26728143 2016 Variants of FGFR2 and their associations with breast cancer risk: a HUGE systematic review and meta-analysis.
26687682 2016 Two FGF Receptor Kinase Molecules Act in Concert to Recruit and Transphosphorylate Phospholipase C?.
26613250 2016 Effects of FGFR Signaling on Cell Proliferation and Differentiation of Apert Dental Cells.
26575424 2015 Formononetin, a novel FGFR2 inhibitor, potently inhibits angiogenesis and tumor growth in preclinical models.
26574622 2016 Antitumor effects and molecular mechanisms of ponatinib on endometrial cancer cells harboring activating FGFR2 mutations.
26551078 2016 Nuclear staining of fgfr-2/stat-5 and runx-2 in mucinous breast cancer.
26516773 2015 Evaluation of Fibroblast Growth Factor Receptor 2 Expression, Heterogeneity and Clinical Significance in Gastric Cancer.
26506517 2015 The impact of RNA binding motif protein 4-regulated splicing cascade on the progression and metabolism of colorectal cancer cells.
More...