Property Summary

NCBI Gene PubMed Count 487
Grant Count 430
R01 Count 266
Funding $57,038,329.79
PubMed Score 1138.65
PubTator Score 1106.77

Knowledge Summary

Patent (141,681)

TINX Plot

  Disease Relevance (87)

Disease Z-score Confidence
Craniosynostosis 47 7.631 3.8
Acrocephalosyndactylia 15 7.567 3.8
Syndactyly 56 5.429 2.7
Antley-Bixler syndrome 15 5.364 2.7
Cancer 2,346 5.134 2.6
Exophthalmos 16 5.129 2.6
Beare-Stevenson cutis gyrata syndrome 2 5.082 2.5
LADD syndrome 9 4.276 2.1
Achondroplasia 20 4.231 2.1
Acanthosis nigricans 14 4.14 2.1
Cleft palate 125 3.904 2.0
Humeroradial synostosis 2 3.803 1.9
Thanatophoric dysplasia 5 3.796 1.9
Hypochondroplasia 11 3.594 1.8
Choanal atresia 19 3.42 1.7
Distal 10q deletion syndrome 5 3.314 1.7
Hypospadias 65 3.232 1.6
Cholesteatoma 13 3.16 1.6
Hydrocephalus 60 3.062 1.5
Ankylosis 25
Antley-Bixler Syndrome Phenotype 2
Antley-Bixler Syndrome, Autosomal Domina... 2 
Apert syndrome 1
BENT BONE DYSPLASIA SYNDROME 1
Breast cancer 3,094 2.0
Carcinoma 2,147 1.0
Cholangiocarcinoma 32
Cleft Lip 91
Craniofacial Abnormalities 147
Craniofacial Dysostosis 1
Craniofacial dysostosis type 1 2
Crouzon syndrome 2 5.0
Cutis Gyrata Syndrome of Beare And Steve... 1 
Dermatologic disorders 65
Down syndrome 548
Drug-induced mucositis 1
Endometrial Neoplasms 50
Endometrial cancer 25 1.0
Endometrial carcinoma 18
Gout 93 1.0
Hamartoma Syndrome, Multiple 9
Hamman-Rich syndrome 35
Hydrolethalus syndrome 128
Intellectual disability 573 4.0
JACKSON-WEISS SYNDROME 2
Lacrimoauriculodentodigital syndrome 3
Limb Deformities, Congenital 16
Liver Cirrhosis 101
Lung Neoplasms 171
Malignant neoplasm of breast 63
Mammary Neoplasms 410
Motor Skills Disorders 6
Mucositis following radiation therapy 1
Pfeiffer Syndrome 2 5.0
Pfeiffer type acrocephalosyndactyly 2
Plagiocephaly, Nonsynostotic 1
Prevention of Radiation Therapy-Induced ... 1 
Prostate cancer 172 5.0
SCAPHOCEPHALY, MAXILLARY RETRUSION, AND ... 1 
Saethre-Chotzen syndrome 9
Skin Abnormalities 10
Stomach Neoplasms 282
Tooth Abnormalities 10
adrenocortical carcinoma 1,427
aldosterone-producing adenoma 664
atypical teratoid / rhabdoid tumor 4,369
breast carcinoma 1,614
colon cancer 1,475
cutaneous lupus erythematosus 1,056
glioblastoma 5,572
group 3 medulloblastoma 2,254
intraductal papillary-mucinous neoplasm ... 3,289 
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
non primary Sjogren syndrome sicca 840
non-small cell lung cancer 2,798
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
spina bifida 1,064
subependymal giant cell astrocytoma 2,287
ulcerative colitis 2,087

Expression

  Differential Expression (25)

Gene

PDB

1NUN   1EV2   1II4   1IIL   2FDB   1DJS   1E0O   1GJO   1OEC   1WVZ   2PSQ   2PVF   2PVY   2PWL   2PY3   2PZ5   2PZP   2PZR   2Q0B   3B2T   3CAF   3CLY   3CU1   3DAR   3EUU   3OJ2   3OJM   3RI1   4J23   4J95   4J96   4J97   4J98   4J99   4WV1   5EG3  

  TechDev Info (2)

Gary Johnson Kinome profile via MIB/MS Technology
Michael McManus Genetic interaction screen

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (391)

PMID Text
26853422 Results suggest, a potential role for PIK3CA, VEGFR2, RET and FGFR2 as therapeutic targets in EGFR non-mutated NSCLC that requires further clinical validation.
26743380 The association of the FGFR2 gene with risk of overall and ER-positive breast cancer.
26728143 FGFR2 is a breast cancer susceptibility gene.
26687682 FGFR1/2 act in concert to recruit and transphosphorylate phospholipase Cgamma1.
26613250 this study shows preliminary evidence for the role of FGFR signaling in the proliferation and differentiation of Apert dental pulp and enamel organ epithelia cells.
26575424 Formononetin targets the FGFR2-mediated Akt signaling pathway, leading to the suppression of tumor growth and angiogenesis in breast neoplasms.
26574622 for the first time, report the molecular mechanisms by which AP24534 exerts antitumor effects on ECs with FGFR2 activating mutations, which would provide mechanistic insight into ongoing clinical investigations of AP24534 for ECs.
26551078 that STAT-5, RUNX-2, and FGFR-2 may have a role in the progression of the mucinous phenotype, in which nuclear STAT-5 may inhibit RUNX-2 prometastatic effect
26516773 intratumoral heterogeneity and discordant FGFR2b expression in primary tumors and metastatic lymph nodes are common in gastric cancer
26506517 High FGFR2 expression is associated with colorectal cancer.
More...

AA Sequence

MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVI      1 - 70
SWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGA     71 - 140
EDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVR    141 - 210
NQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKV    211 - 280
YSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGI    281 - 350
SFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTK    351 - 420
RIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEG    421 - 490
CFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPL    491 - 560
YVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAAR    561 - 630
NVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLG    631 - 700
GSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYL    701 - 770
DLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT                       771 - 821
//

Text Mined References (505)

PMID Year Title
26853422 Genomic profiling in a homogeneous molecular subtype of non-small cell lung cancer: An effort to explore new drug targets.
26743380 2016 Gene-based analysis of the fibroblast growth factor receptor signaling pathway in relation to breast cancer in African American women: the AMBER consortium.
26728143 2016 Variants of FGFR2 and their associations with breast cancer risk: a HUGE systematic review and meta-analysis.
26687682 2016 Two FGF Receptor Kinase Molecules Act in Concert to Recruit and Transphosphorylate Phospholipase C?.
26613250 2016 Effects of FGFR Signaling on Cell Proliferation and Differentiation of Apert Dental Cells.
26575424 2015 Formononetin, a novel FGFR2 inhibitor, potently inhibits angiogenesis and tumor growth in preclinical models.
26574622 2016 Antitumor effects and molecular mechanisms of ponatinib on endometrial cancer cells harboring activating FGFR2 mutations.
26551078 2016 Nuclear staining of fgfr-2/stat-5 and runx-2 in mucinous breast cancer.
26516773 2015 Evaluation of Fibroblast Growth Factor Receptor 2 Expression, Heterogeneity and Clinical Significance in Gastric Cancer.
26506517 2015 The impact of RNA binding motif protein 4-regulated splicing cascade on the progression and metabolism of colorectal cancer cells.
More...