Property Summary

NCBI Gene PubMed Count 131
Grant Count 471
R01 Count 258
Funding $69,223,437.76
PubMed Score 1462.21
PubTator Score 495.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -4.600 0.000
type II diabetes mellitus and post-ische... -1.200 0.021
non-small cell lung cancer -1.053 0.000
intraductal papillary-mucinous neoplasm ... -1.200 0.000
colon cancer -1.900 0.013
lung cancer -2.500 0.000
interstitial cystitis 1.800 0.001
non primary Sjogren syndrome sicca -1.200 0.031
psoriasis -1.200 0.000
lung carcinoma -1.700 0.000
invasive ductal carcinoma -1.600 0.002
Breast cancer -1.100 0.007

Synonym

Accession P21781 H0YNY5 Q6FGV5 Q96FG5 FGF-7
Symbols KGF
HBGF-7

Gene

PANTHER Protein Class (2)

Gene RIF (94)

PMID Text
26574554 In the current study, conditioned media and chemically defined media with recombinant human keratinocyte growth factor (KGF) could induce hUC-MSC differentiation into sweat gland-like cells (SGCs).
26514676 This study evaluated the expression of FGF7, AhR, and CYP1A1 in colorectal cancer cells and revealed a new mechanism by which KGF promotes cell proliferation through the AhR-cyclin D1 pathway in colon cancer cells.
26350198 Coexpression of KGF and MMP-9 in gastric cancer could be a useful prognostic factor, and MMP-9 might also serve as a novel target for both prognostic prediction and therapeutics.
25623741 FGF7 over expression is associated with advanced clinical features in patients with upper tract and bladder urothelial carcinoma
25313018 Data indicate the key roles played, on the melanosome transfer in normal skin, by KGF/FGF7 released by dermal fibroblasts and by its receptor KGFR/FGFR2b expressed and activated on the epidermal keratinocytes.
25138153 KGF expression induced epithelial cell proliferation, reaching a peak level at day 4 and then decreased later, while in the long-term model, KGF expression in the EAC led to middle ear cholesteatoma formation
24783215 Recombinant keratinocyte growth factor 1 in tobacco potentially promotes wound healing in diabetic rats.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of fibroblast growth factor 7 (FGF7; KGF: keratinocyte growth factor) in primary human brain microvascular endothelial cells
24577098 First evidence of a role of FGF7 in the regulation of sequential steps of the autophagic process and strengthen the hypothesis of a direct interplay between autophagy and differentiation.
24434934 These findings indicate that topically delivered KGF-1 DNA plasmid can increase epithelial thickness and strength, demonstrating the potential of this approach to restore compromised skin.
More...

AA Sequence

MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLF      1 - 70
CRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFK     71 - 140
ELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT                    141 - 194
//

Text Mined References (136)

PMID Year Title
26574554 2016 Role of Keratinocyte Growth Factor in the Differentiation of Sweat Gland-Like Cells From Human Umbilical Cord-Derived Mesenchymal Stem Cells.
26514676 2016 Keratinocyte Growth Factor Regulation of Aryl Hydrocarbon Receptor Activation in Colorectal Cancer Cells.
26350198 Clinicopathological correlation of keratinocyte growth factor and matrix metalloproteinase-9 expression in human gastric cancer.
25623741 2015 FGF7 Over Expression is an Independent Prognosticator in Patients with Urothelial Carcinoma of the Upper Urinary Tract and Bladder.
25313018 2014 Decreased expression of KGF/FGF7 and its receptor in pathological hypopigmentation.
25138153 2015 In vivo over-expression of KGF mimic human middle ear cholesteatoma.
24783215 2014 Recombinant keratinocyte growth factor 1 in tobacco potentially promotes wound healing in diabetic rats.
24577098 2014 FGF7/KGF regulates autophagy in keratinocytes: A novel dual role in the induction of both assembly and turnover of autophagosomes.
24434934 2014 Strengthening the skin with topical delivery of keratinocyte growth factor-1 using a novel DNA plasmid.
24426773 2014 Differential effects of hepatocyte growth factor and keratinocyte growth factor on corneal epithelial cell cycle protein expression, cell survival, and growth.
More...