Property Summary

NCBI Gene PubMed Count 135
PubMed Score 1534.12
PubTator Score 495.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -1.100 6.6e-03
colon cancer -1.900 1.3e-02
interstitial cystitis 1.800 1.4e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.8e-04
invasive ductal carcinoma -1.600 1.6e-03
lung cancer -2.500 5.1e-06
lung carcinoma -1.700 5.7e-15
malignant mesothelioma -4.600 4.3e-08
non primary Sjogren syndrome sicca -1.200 3.1e-02
non-small cell lung cancer -1.053 3.0e-12
psoriasis -1.200 3.6e-06
type II diabetes mellitus and post-ische... -1.200 2.1e-02

Protein-protein Interaction (1)

Gene RIF (98)

AA Sequence

MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLF      1 - 70
CRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFK     71 - 140
ELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT                    141 - 194
//

Text Mined References (140)

PMID Year Title