Property Summary

NCBI Gene PubMed Count 33
Grant Count 104
R01 Count 70
Funding $12,147,302.78
PubMed Score 593.93
PubTator Score 197.45

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P21754 Q06633 Q29RW0
Symbols ZPC
ZP3A
ZP3B
Zp-3

Gene

ZP3

Gene RIF (13)

PMID Text
24334245 Epididymal CRISP1 mediates sperm-zona pellucida binding through its interaction with ZP3.
22889493 observed sequence variations in exons of ZP3 gene in women with infertility of unknown origin who exhibit abnormal zona pellucida; sperm-ovum interactions appear relatively normal in these patients [CASE REPORTS]
20237496 Observational study of gene-disease association. (HuGE Navigator)
19246320 The functional activity of human ZP3 resides in its C-terminal domain.
19004505 a significant decrease in acrosomal exocytosis mediated by both recombinant human ZP3 (p<0.005) and ZP4 (p<0.005) was observed in presence of the immune sera
18667750 induces acrosome reactions which are protein kinase-C, protein tyrosine kinase, T-type Ca2+ channels, and extracellular Ca2+ dependent
18502569 may have a role in the development of primordial follicle before zona pellucida formation
18033806 ZP proteins were detected in both the oocyte and the granulosa cells as early as the primordial follicle stage in the human. The detection of ZP proteins in the quiescent primordial follicle suggests that these proteins have been present since oogenesis.
17192598 Peptides rhuZP3a22 approximately 176 and rhuZP3b177 approximately 348 have a role similar to human ZP3. The mechanism of the response to the peptides involves influx of calcium, the G protein pathway, and a T-type calcium channel.
16407501 Exposure of sperm to ZP proteins promoted acrosomal exocytosis and changed motility patterns.
More...

AA Sequence

MELSYRLFICLLLWGSTELCYPQPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLFGTGKLIRAAD      1 - 70
LTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRPVGNLSIVRTNRAEIPIEC     71 - 140
RYPRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPL    141 - 210
RLFVDHCVATPTPDQNASPYHTIVDFHGCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYI    211 - 280
TCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGSADICQCCNKGDCGTPSHSRRQPHVMSQWSRSASRN    281 - 350
RRHVTEEADVTVGPLIFLDRRGDHEVEQWALPSDTSVVLLGVGLAVVVSLTLTAVILVLTRRCRTASHPV    351 - 420
SASE                                                                      421 - 424
//

Text Mined References (35)

PMID Year Title
24334245 2014 Human fertilization: epididymal hCRISP1 mediates sperm-zona pellucida binding through its interaction with ZP3.
22889493 2012 Genetic and physiological study of morphologically abnormal human zona pellucida.
20394732 2010 Recombinant human ZP3-induced sperm acrosome reaction: evidence for the involvement of T- and L-type voltage-gated calcium channels.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19945174 2010 Identification of human sperm proteins that interact with human zona pellucida3 (ZP3) using yeast two-hybrid system.
19700799 2009 Binding characteristics of sperm with recombinant human zona pellucida glycoprotein-3 coated beads.
19246320 2009 Functional activity of human ZP3 primary sperm receptor resides toward its C-terminus.
19004505 2009 DNA vaccine encoding chimeric protein encompassing epitopes of human ZP3 and ZP4: immunogenicity and characterization of antibodies.
18667750 2008 Effects of native human zona pellucida glycoproteins 3 and 4 on acrosome reaction and zona pellucida binding of human spermatozoa.
18502569 2008 Zona pellucida components are present in human fetal ovary before follicle formation.
More...