Property Summary

NCBI Gene PubMed Count 37
PubMed Score 603.64
PubTator Score 197.45

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

AA Sequence

MELSYRLFICLLLWGSTELCYPQPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLFGTGKLIRAAD      1 - 70
LTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRPVGNLSIVRTNRAEIPIEC     71 - 140
RYPRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPL    141 - 210
RLFVDHCVATPTPDQNASPYHTIVDFHGCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYI    211 - 280
TCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGSADICQCCNKGDCGTPSHSRRQPHVMSQWSRSASRN    281 - 350
RRHVTEEADVTVGPLIFLDRRGDHEVEQWALPSDTSVVLLGVGLAVVVSLTLTAVILVLTRRCRTASHPV    351 - 420
SASE                                                                      421 - 424
//

Text Mined References (39)

PMID Year Title