Property Summary

Ligand Count 3
NCBI Gene PubMed Count 143
PubMed Score 610.64
PubTator Score 121.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 2.000 2.4e-05
lung adenocarcinoma 3.200 2.3e-15

Gene RIF (115)

AA Sequence

MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRC      1 - 70
RVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGK     71 - 140
GKD                                                                       141 - 143
//

Text Mined References (144)

PMID Year Title