Property Summary

NCBI Gene PubMed Count 136
Grant Count 69
R01 Count 40
Funding $6,076,977.48
PubMed Score 580.46
PubTator Score 121.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma 3.200 0.000
Breast cancer 2.000 0.000

Synonym

Accession P21741 Q2LEK4 Q9UCC7 MK
Symbols MK
ARAP
NEGF2

Gene

MDK

PANTHER Protein Class (2)

PDB

1MKC   1MKN  

Gene RIF (108)

PMID Text
27089523 The concentration of MDK in amniotic fluid declined with gestational age.MDK concentrations in amniotic fluid were far higher than in maternal plasma.
26656665 MDK plays an important role in non-small cell lung cancer progression and prognosis and may act as a convincing prognostic indicator for non-small cell lung cancer patients.
26642712 PLSCR1 positively regulates hepatic carcinoma cell proliferation and migration through interacting with midkine
26566633 MK was significantly elevated in vitamin D deficiency and associated with anti-Saccharomyces cerevisiae antibodies positivity which was significantly increased in vitamin D deficiency
26297257 our results suggest that midkine expression could be a clinically useful marker in predicting the presence of multiple lymph node metastases in BRAFV600E papillary thyroid carcinoma.
26159850 overexpression of midkine protein serves as an unfavorable prognostic biomarker in breast cancer patients
25817231 midkine is as good as or even better than thyroglobulin to screen patients with thyroid nodules for differentiated thyroid cancer before surgery, and to predict whether metastases exist
25787827 The Circulating Levels of Selenium, Zinc, Midkine, Some Inflammatory Cytokines, and Angiogenic Factors in Mitral Chordae Tendineae Rupture.
25655295 Use hybrid-type modified chitosan derivative nanoparticles to deliver midkine-siRNA to HepG2 cells.
25428991 SP1 directly up-regulated the expression of midkine (MDK), and the SP1-MDK axis cooperated in glioma tumorigenesis.
More...

AA Sequence

MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRC      1 - 70
RVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGK     71 - 140
GKD                                                                       141 - 143
//

Text Mined References (137)

PMID Year Title
27089523 2016 Midkine and Pleiotrophin Concentrations in Amniotic Fluid in Healthy and Complicated Pregnancies.
26656665 2015 MDK Protein Overexpression Correlates with the Malignant Status and Prognosis of Non-small Cell Lung Cancer.
26642712 2015 Phospholipid Scramblase 1 Interacts with Midkine and Regulates Hepatic Cancer Cell Proliferation and Migration.
26566633 2016 Midkine in vitamin D deficiency and its association with anti-Saccharomyces cerevisiae antibodies.
26297257 2015 Strong immunoexpression of midkine is associated with multiple lymph node metastases in BRAFV600E papillary thyroid carcinoma.
26159850 2015 The clinical and prognostic significance of midkine in breast cancer patients.
25817231 2015 Evaluation of serum midkine as a biomarker in differentiated thyroid cancer.
25787827 2015 The Circulating Levels of Selenium, Zinc, Midkine, Some Inflammatory Cytokines, and Angiogenic Factors in Mitral Chordae Tendineae Rupture.
25655295 2015 Development of hybrid-type modified chitosan derivative nanoparticles for the intracellular delivery of midkine-siRNA in hepatocellular carcinoma cells.
25428991 2015 Transcriptional factor specificity protein 1 (SP1) promotes the proliferation of glioma cells by up-regulating midkine (MDK).
More...