Property Summary

Ligand Count 296
NCBI Gene PubMed Count 124
PubMed Score 123.41
PubTator Score 273.71

Knowledge Summary

Patent (5,832)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.300 2.5e-03
Astrocytoma, Pilocytic 1.400 1.2e-07
atypical teratoid / rhabdoid tumor -1.200 1.0e-04
glioblastoma 1.300 1.0e-07
osteosarcoma -2.258 5.3e-07
psoriasis -2.500 1.1e-04
spina bifida 1.048 4.6e-02

Gene RIF (103)

AA Sequence

MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTRSSFLTFLCGL      1 - 70
VLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPLLLGAAMASERYLGITRPFSR     71 - 140
PAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPGSWCFLTLGAESGDVAFGLLFSMLGGLSVGL    141 - 210
SFLLNTVSVATLCHVYHGQEAAQQRPRDSEVEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAG    211 - 280
QLSRTTEKELLIYLRVATWNQILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ           281 - 343
//

Text Mined References (126)

PMID Year Title