Property Summary

NCBI Gene PubMed Count 120
Grant Count 34
R01 Count 21
Funding $3,495,980.55
PubMed Score 118.20
PubTator Score 273.71

Knowledge Summary

Patent (5,832)

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -2.600 0.000
osteosarcoma -2.258 0.000
glioblastoma 1.700 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
pediatric high grade glioma 1.500 0.000
pilocytic astrocytoma 1.400 0.000
spina bifida 1.048 0.046

Gene RIF (99)

PMID Text
26724804 Data suggest that thromboxane A2/TBXA2R signaling promotes multiple myeloma cell proliferation by reducing delay at G2/M phase via up-regulation of MAP kinase pathway, up-regulation of cyclin B1/CDK1 expression, and down-regulation of apoptosis.
25557379 The results of this study show that TXA2R polymorphisms may affect platelet function and the risk of developing cerebral ischemia.
25202904 Which could be attenuated by treatment with a TP antagonist (PTXA2).
24996187 TXA2 receptor associated with lipid rafts in platelets is important for functional platelet responses to TXA2
24490858 Data suggest TBXA2R requires Ser324 for normal activity; Ser324A mutant is insensitive to activation by protein kinase A/cell hypoxia, has high affinity for agonists (thromboxane A2/analogs), and participates in agonist-induced calcium mobilization.
24384873 TXA2 should be regarded as a critical molecule in COX-2-mediated tumor growth and a valuable target against lung cancer.
23840660 Human thromboxane A2 receptor genetic variant V80E exhibited reduced platelet activation whereas A160T demonstrated platelet hyperactivity.
23555978 Non-conservative substitution of E3.49 and E6.30 in prostanoid TP receptor results in superactive mutants that are more efficient in G protein coupling and activation.
23517037 Genetic variants were identified in the TBXA2R gene that influenced transcriptional activity and were associated with asthma-related phenotypes.
23493750 Targeting the TPalpha-TM5 GxxxGxxxL domain may allow development of biased TPalpha homodimer antagonists that avoid suppression of IP-TPalpha heterodimer function.
More...

AA Sequence

MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTRSSFLTFLCGL      1 - 70
VLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPLLLGAAMASERYLGITRPFSR     71 - 140
PAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPGSWCFLTLGAESGDVAFGLLFSMLGGLSVGL    141 - 210
SFLLNTVSVATLCHVYHGQEAAQQRPRDSEVEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAG    211 - 280
QLSRTTEKELLIYLRVATWNQILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ           281 - 343
//

Text Mined References (122)

PMID Year Title
26724804 2016 Thromboxane A2 Receptor Inhibition Suppresses Multiple Myeloma Cell Proliferation by Inducing p38/c-Jun N-terminal Kinase (JNK) Mitogen-activated Protein Kinase (MAPK)-mediated G2/M Progression Delay and Cell Apoptosis.
25557379 2015 Thromboxane A2 receptor polymorphism in association with cerebral infarction and its regulation on platelet function.
25202904 2014 Regulation of the tumor suppressor FOXO3 by the thromboxane-A2 receptors in urothelial cancer.
24996187 2014 The association of thromboxane A2 receptor with lipid rafts is a determinant for platelet functional responses.
24490858 2014 Thromboxane receptor hyper-responsiveness in hypoxic pulmonary hypertension requires serine 324.
24384873 2014 Thromboxane A2 exerts promoting effects on cell proliferation through mediating cyclooxygenase-2 signal in lung adenocarcinoma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23840660 2013 Human thromboxane A2 receptor genetic variants: in silico, in vitro and "in platelet" analysis.
23555978 2013 Full and partial agonists of thromboxane prostanoid receptor unveil fine tuning of receptor superactive conformation and G protein activation.
23517037 2013 Functional variants in the thromboxane A2 receptor gene are associated with lung function in childhood-onset asthma.
More...