Property Summary

Ligand Count 167
NCBI Gene PubMed Count 121
PubMed Score 542.89
PubTator Score 1449.19

Knowledge Summary

Patent (173,269)

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.619 4.9e-03
Astrocytoma, Pilocytic 1.100 1.2e-02
atypical teratoid / rhabdoid tumor 1.200 2.6e-02
chronic lymphosyte leukemia -1.700 5.5e-11
cutaneous lupus erythematosus 1.600 2.6e-03
ependymoma 1.600 1.8e-05
gastric cancer -1.500 2.4e-02
glioblastoma 1.100 2.3e-02
interstitial cystitis 1.400 9.7e-03
invasive ductal carcinoma 2.004 2.7e-03
lung adenocarcinoma -1.438 1.2e-05
lung cancer -2.900 1.6e-04
lung carcinoma -2.000 3.9e-21
malignant mesothelioma 1.500 2.0e-05
mucosa-associated lymphoid tissue lympho... 2.496 7.2e-03
non-small cell lung cancer -2.005 2.5e-20
osteosarcoma -2.747 2.5e-03
ovarian cancer -2.000 1.3e-06
pediatric high grade glioma 1.200 2.7e-02
psoriasis -2.700 1.2e-04
subependymal giant cell astrocytoma 2.555 2.3e-02
ulcerative colitis 2.100 1.3e-03

Protein-protein Interaction (1)

C5  

Gene RIF (103)

AA Sequence

MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTI      1 - 70
NAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFK     71 - 140
PIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDYSHDKRRERAVAIVRLVLG    141 - 210
FLWPLLTLTICYTFILLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKK    211 - 280
LDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV    281 - 350
//

Text Mined References (129)

PMID Year Title