Property Summary

NCBI Gene PubMed Count 108
Grant Count 182
R01 Count 145
Funding $14,890,392.69
PubMed Score 497.70
PubTator Score 1449.19

Knowledge Summary

Patent (173,269)

Expression

Synonym

Accession P21730
Symbols C5A
C5AR
C5R1
CD88

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (89)

PMID Text
26475622 that C5aR stimulates cell invasion and migration via ERK1/2-mediated epithelial-mesenchymal transition in hepatocellular carcinoma cells
26176669 Inhibition of C5aR1 leads to a significant reduction of CD66b and CD11b expression indicating a lower neutrophil activation status and block of granule exocytosis.
26059553 C5a/C5aR1 signalling plays a key role in disrupting blood-brain barrier integrity through different cascades including NF-KappaB translocation leading to altered tight junction proteins, Claudin-5 and ZO-1, and actin reorganization in the lupus setting
25924896 that rs10853784 of C5aR1 gene are associated with coronary artery disease in Han population of China
25726869 C5AR and C5L2-mediated neutrophil dysfunction is associated with a poor outcome in sepsis.
25682807 96.7% of the metastatic RCCs had C5aR expression, vs. 50.5% of the non-metastatic ones. C5a triggered ERK- and PI3Kdependent invasion of the C5aR-expressing renal carcinoma cells. The C5a-C5aR axis plays a crucial role in renal carcinoma cell invasion.
25582053 ). Low frequency of the C5aR 450 CT genotype, which apparently is a feature of certain kidney diseases, appears to be associated with good graft outcome in kidney transplantation.
25544179 Observed a positive correlation between the expression of anaphylatoxin-receptors C3aR and C5aR with platelet activation in patients with coronary artery disease.
25455139 C5AR1 SNP -1330T/G may serve as a useful pharmacodynamic predictor of nonsedating H1-antihistamine efficacy in chronic spontaneous urticaria (CSU), and -1330T alleles may be taken as a risk factor for CSU.
25174320 These results illustrate the novel activity of the C5a-C5aR axis that promotes human NPC cell proliferation through PCAFmediated STAT3 acetylation.
More...

AA Sequence

MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTI      1 - 70
NAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFK     71 - 140
PIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDYSHDKRRERAVAIVRLVLG    141 - 210
FLWPLLTLTICYTFILLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKK    211 - 280
LDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV    281 - 350
//

Text Mined References (116)

PMID Year Title
26475622 2016 C5a receptor enhances hepatocellular carcinoma cell invasiveness via activating ERK1/2-mediated epithelial-mesenchymal transition.
26176669 2015 CD66b Overexpression and Loss of C5a Receptors as Surface Markers for Staphylococcus aureus-Induced Neutrophil Dysfunction.
26059553 2015 C5a alters blood-brain barrier integrity in a human in vitro model of systemic lupus erythematosus.
25924896 2015 Association of C5aR1genetic polymorphisms with coronary artery disease in a Han population in Xinjiang, China.
25726869 2016 Complement 5a receptor-mediated neutrophil dysfunction is associated with a poor outcome in sepsis.
25682807 2015 C5aR is frequently expressed in metastatic renal cell carcinoma and plays a crucial role in cell invasion via the ERK and PI3 kinase pathways.
25582053 2015 Complement C5a receptor gene 450 C/T polymorphism in renal transplant recipients: association of the CT genotype with graft outcome.
25544179 2015 Expression of anaphylatoxin receptors on platelets in patients with coronary heart disease.
25455139 2014 Influence of component 5a receptor 1 (C5AR1) -1330T/G polymorphism on nonsedating H1-antihistamines therapy in Chinese patients with chronic spontaneous urticaria.
25174320 2014 C5a promotes the proliferation of human nasopharyngeal carcinoma cells through PCAF-mediated STAT3 acetylation.
More...