Property Summary

Ligand Count 422
NCBI Gene PubMed Count 258
PubMed Score 294.24
PubTator Score 541.10

Knowledge Summary

Patent (8,536)

TINX Plot

  Disease (6)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma -1.500 5.3e-38
Astrocytoma, Pilocytic -1.100 4.9e-04
glioblastoma -1.300 3.1e-05
group 4 medulloblastoma -1.200 1.1e-02
oligodendroglioma -1.500 3.6e-26
pediatric high grade glioma -1.200 2.6e-04
posterior fossa group B ependymoma 1.600 1.4e-04
primitive neuroectodermal tumor -1.200 6.9e-04

Gene RIF (244)

AA Sequence

MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSD      1 - 70
LLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAA     71 - 140
FILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDSSLSRTYAISSSVISFYIPVAIM    141 - 210
IVTYTRIYRIAQKQIRRIAALERAAVHAKNCQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGV    211 - 280
FVCCWLPFFILNCILPFCGSGETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRL    281 - 350
CPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL    351 - 420
SVILDYDTDVSLEKIQPITQNGQHPT                                                421 - 446
//

Text Mined References (261)

PMID Year Title