Property Summary

NCBI Gene PubMed Count 243
Grant Count 182
R01 Count 85
Funding $27,999,118.67
PubMed Score 283.01
PubTator Score 541.10

Knowledge Summary

Patent (8,536)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma -1.500 0.000
glioblastoma multiforme -1.600 0.000
oligodendroglioma -1.500 0.000
medulloblastoma -1.200 0.000
primitive neuroectodermal tumor -1.200 0.001
pediatric high grade glioma -1.200 0.000
pilocytic astrocytoma -1.200 0.000
posterior fossa group B ependymoma 1.600 0.000

Synonym

Accession P21728 B2RA44 Q4QRJ0
Symbols DADR
DRD1A

Gene

PANTHER Protein Class (2)

PDB

1OZ5  

  TechDev Info (1)

MLP Assay (26)

AID Type Active / Inconclusive / Inactive Description
858 confirmatory 226 / 0 / 291 Allosteric Modulators of D1 Receptors: Dose-dependent Assay
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
2542 summary 0 / 0 / 0 Allosteric Modulators of D1 Receptors
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
488981 confirmatory 39 / 50 / 1191 HTS Assay for Allosteric Agonists of the Human D1 Dopamine Receptor: Primary Screen for Agonists
488982 confirmatory 22 / 92 / 1152 HTS Assay for Allosteric Agonists of the Human D1 Dopamine Receptor: Primary Screen for Potentiators
488983 confirmatory 114 / 127 / 1039 HTS Assay for Allosteric Agonists of the Human D1 Dopamine Receptor: Primary Screen for Antagonists
488989 summary 0 / 0 / 0 HTS Assay for Allosteric Agonists of the Human D1 Dopamine Receptor: Summary
488993 summary 0 / 0 / 0 HTS Assay for Positive Allosteric Modulators of the Human D1 Dopamine Receptor: Summary
More...

Gene RIF (229)

PMID Text
26957229 the DRD1 gene is implicated in the pathophysiology of psychosis and support the dopamine hypothesis of schizophrenia.
26730182 In the dominant model, rs4532 locus of DRD1 gene was related to hypertension with a pooled OR of 1.353 (95% CI =1.016-1.802, P=0.038). [meta-analysis]
26723139 This study revealed that the factors of schizotypy resembling the negative symptoms of schizophrenia are associated with the minor rs4532/C allele of 4532 SNP on the DRD1 gene.
26665568 The observed frequency of dopamine DRD1 and DRD4 polymorphisms is similar to the distribution of these variants in other Caucasian populations
26593092 Dopamine D1 receptor-expressing neurons provide the dominant source of accumbal inhibition to lateral hypothalamus to control over feeding.
26484506 Dopamine D1 receptor (DRD1) 5' region haplotypes significantly affect transcriptional activity in vitro
26419600 on a sequence learning task in 161 Caucasian participants, the DRD1 polymorphism predicted the ability to learn new sequences
26186971 Conserved residues in intracellular loop 1 and transmembrane region 2 of DRD1 and DRD5 are essential in ligand binding and signal transduction.
26041607 No significant association between candidate gene variants and criminal behavior was detected.
25896831 Polymorphisms in DRD1, DRD2 and GRIN2B confer increased risk of impulse control problems among PD patients.
More...

AA Sequence

MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSD      1 - 70
LLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAA     71 - 140
FILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDSSLSRTYAISSSVISFYIPVAIM    141 - 210
IVTYTRIYRIAQKQIRRIAALERAAVHAKNCQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGV    211 - 280
FVCCWLPFFILNCILPFCGSGETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRL    281 - 350
CPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL    351 - 420
SVILDYDTDVSLEKIQPITQNGQHPT                                                421 - 446
//

Text Mined References (246)

PMID Year Title
27460146 2016 VPS35 regulates cell surface recycling and signaling of dopamine receptor D1.
26957229 2016 Associations between a locus downstream DRD1 gene and cerebrospinal fluid dopamine metabolite concentrations in psychosis.
26730182 2016 Association between GRK4 and DRD1 gene polymorphisms and hypertension: a meta-analysis.
26723139 2016 The dopamine D1 receptor gene is associated with negative schizotypy in a non-clinical sample.
26665568 2015 DRD1 and DRD4 dopamine receptors in the etiology of preeclampsia.
26593092 2015 Accumbal D1R Neurons Projecting to Lateral Hypothalamus Authorize Feeding.
26484506 2015 Dopamine D1 receptor (DRD1) 5' region haplotypes significantly affect transcriptional activity in vitro.
26419600 2015 Commonly-occurring polymorphisms in the COMT, DRD1 and DRD2 genes influence different aspects of motor sequence learning in humans.
26186971 2015 Functional importance of two conserved residues in intracellular loop 1 and transmembrane region 2 of Family A GPCRs: insights from ligand binding and signal transduction responses of D1 and D5 dopaminergic receptor mutants.
26041607 2015 Serotonin and Dopamine Candidate Gene Variants and Alcohol- and Non-Alcohol-Related Aggression.
More...