Property Summary

NCBI Gene PubMed Count 55
Grant Count 771
R01 Count 412
Funding $121,510,908.16
PubMed Score 1129.83
PubTator Score 76.76

Knowledge Summary

Patent (54,104)

Expression

  Differential Expression (2)

Disease log2 FC p
esophageal adenocarcinoma -1.100 0.050
psoriasis 2.100 0.000

Synonym

Accession P21709 A1L3V3 B5A966 B5A967 Q15405 hEpha1
Symbols EPH
EPHT
EPHT1

Gene

PDB

2K1K   2K1L   3HIL   3KKA  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (34)

PMID Text
26977017 EPHA1 suppresses spreading and adhesion of HRT18 colorectal cancer cells through deactivation of ERK and JNK signaling pathways.
26261568 Data indicate that EphA1 protein may be a new marker for the prognosis of clear cell renal cell carcinoma.
25451169 EphrinA1 plays an important role in the TNF-alpha-mediated adhesion of monocytes to endothelial cells.
25391265 High expression of EphA1 was associated with metastasis and recurrence in Gastric Cancer.
25286141 two states of the EphA1 transmembrane helix dimer
25182741 This study suggests EPHA1 (rs11771145) interferes with the pathological alteration of the hippocampus and the lateral occipitotemporal and inferior temporal gyri throughout the Alzheimer's disease process, leading to a lower risk of Alzheimer's disease.
25025847 Lack of ephrin receptor A1 is a favorable independent prognostic factor in clear cell renal cell carcinoma.
24040450 Suggest EphA1 receptor may have roles in carcinogenesis and progression of prostate cancer.
23429488 High Eph A1 expression is associated with choriocarcinoma invasion.
23030051 Results show that EphA1 appears to be a differentiation marker for esophageal squamous cells, and its increased expression is positively associated with lymph node metastasis and advanced disease stage.
More...

AA Sequence

MERRWPLGLGLVLLLCAPLPPGARAKEVTLMDTSKAQGELGWLLDPPKDGWSEQQQILNGTPLYMYQDCP      1 - 70
MQGRRDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCKETFNLLYMESDQDVGIQLRRP     71 - 140
LFQKVTTVAADQSFTIRDLVSGSVKLNVERCSLGRLTRRGLYLAFHNPGACVALVSVRVFYQRCPETLNG    141 - 210
LAQFPDTLPGPAGLVEVAGTCLPHARASPRPSGAPRMHCSPDGEWLVPVGRCHCEPGYEEGGSGEACVAC    211 - 280
PSGSYRMDMDTPHCLTCPQQSTAESEGATICTCESGHYRAPGEGPQVACTGPPSAPRNLSFSASGTQLSL    281 - 350
RWEPPADTGGRQDVRYSVRCSQCQGTAQDGGPCQPCGVGVHFSPGARGLTTPAVHVNGLEPYANYTFNVE    351 - 420
AQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLTYELHVLNQDE    421 - 490
ERYQMVLEPRVLLTELQPDTTYIVRVRMLTPLGPGPFSPDHEFRTSPPVSRGLTGGEIVAVIFGLLLGAA    491 - 560
LLLGILVFRSRRAQRQRQQRQRDRATDVDREDKLWLKPYVDLQAYEDPAQGALDFTRELDPAWLMVDTVI    561 - 630
GEGEFGEVYRGTLRLPSQDCKTVAIKTLKDTSPGGQWWNFLREATIMGQFSHPHILHLEGVVTKRKPIMI    631 - 700
ITEFMENGALDAFLREREDQLVPGQLVAMLQGIASGMNYLSNHNYVHRDLAARNILVNQNLCCKVSDFGL    701 - 770
TRLLDDFDGTYETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIE    771 - 840
DGYRLPPPVDCPAPLYELMKNCWAYDRARRPHFQKLQAHLEQLLANPHSLRTIANFDPRMTLRLPSLSGS    841 - 910
DGIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITLPGHQKRILCSIQGFKD        911 - 976
//

Text Mined References (62)

PMID Year Title
26977017 2016 Knockdown of EPHA1 by CRISPR/CAS9 Promotes Adhesion and Motility of HRT18 Colorectal Carcinoma Cells.
26261568 2015 Expression of the EphA1 protein is associated with Fuhrman nuclear grade in clear cell renal cell carcinomas.
25451169 2014 TNF-?-mediated adhesion of monocytes to endothelial cells-The role of ephrinA1.
25391265 2015 Erythropoietin-Producing Hepatocellular A1 is an Independent Prognostic Factor for Gastric Cancer.
25286141 2014 Dimerization of the EphA1 receptor tyrosine kinase transmembrane domain: Insights into the mechanism of receptor activation.
25182741 2015 Effect of EPHA1 genetic variation on cerebrospinal fluid and neuroimaging biomarkers in healthy, mild cognitive impairment and Alzheimer's disease cohorts.
25025847 2014 Lack of ephrin receptor A1 is a favorable independent prognostic factor in clear cell renal cell carcinoma.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
24040450 2013 Increased expression of EphA1 protein in prostate cancers correlates with high Gleason score.
23429488 2013 Eph-ephrin A system regulates human choriocarcinoma-derived JEG-3 cell invasion.
More...