Property Summary

NCBI Gene PubMed Count 23
PubMed Score 53.06
PubTator Score 63.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 1.2668094332249E-24
non-small cell lung cancer 2798 1.77628877373108E-24
lung adenocarcinoma 2714 2.53678571306592E-16
lung carcinoma 2844 5.58106329656142E-12
Duchenne muscular dystrophy 602 2.64701110693591E-5
ductal carcinoma in situ 1745 1.4026794740876E-4
invasive ductal carcinoma 2950 1.77515035527466E-4
acute quadriplegic myopathy 1157 2.53988794892751E-4
breast carcinoma 1614 8.82760043212771E-4
nephrosclerosis 329 0.00513815392640987
Atopic dermatitis 944 0.00705401189310247
fibroadenoma 557 0.00829248212811618
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0422721291418973
Disease Target Count Z-score Confidence
familial hypertriglyceridemia 4 3.247 1.6

Expression

  Differential Expression (13)

Disease log2 FC p
nephrosclerosis -1.252 0.005
psoriasis -2.100 0.000
Duchenne muscular dystrophy -1.056 0.000
acute quadriplegic myopathy -1.340 0.000
Atopic dermatitis -1.800 0.007
pancreatic ductal adenocarcinoma liver m... -1.365 0.042
non-small cell lung cancer -2.086 0.000
breast carcinoma -2.800 0.001
fibroadenoma -3.700 0.008
lung adenocarcinoma -1.500 0.000
lung carcinoma -1.900 0.000
ductal carcinoma in situ -4.200 0.000
invasive ductal carcinoma -5.200 0.000

Synonym

Accession P21695 F8W1L5 Q8N1B0 GPD-C
Symbols GPD-C
HTGTI
GPDH-C

Gene

PANTHER Protein Class (2)

PDB

1WPQ   1X0V   1X0X  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (10)

PMID Text
25884759 The R269A mutation of GPDH1 results in a 110-fold increase in K(m) (2.8 kcal/mol effect) and a 41,000-fold decrease in k(cat) (6.3 kcal/mol effect), which corresponds to a 9.1 kcal/mol destabilization of the transition state.
24549054 massive hepatomegaly, fatty liver and severe hypertriglyceridemia carrying a compound heterozygous mutation in GPD1
22226083 Mutation analysis revealed a homozygous splicing mutation, c.361-1G>C, which resulted in an aberrantly spliced mRNA in the ten affected individuals.
20404019 The expression levels of the GPD1 gene did not differ between patients with OSA and their matched controls. The results were not affected by the clinical and biochemical measurements, the sleep parameters or the severity of nocturnal hypoxemia.
19425502 the discovery overexpression of GPD1 and RRBP1 proteins and lack of expression for HNRNPH1 and SERPINB6 proteins which are new candidate biomarkers of colon cancer.
19296078 The activities of glycerol phosphate dehydrogenase were decreased by 73% in pancreatic islets of patients with type 2 diabetes.
16849634 GpD1 is a weight-loss-responsive gene in skeletal muscle. Its observed transcriptional modulation may decrease triglyceride synthesis, with weight loss.
16460752 The apoenzyme structure of GPD1 has been determined; an electrophilic catalytic mechanism by the epsilon-NH3+ group of Lys204 is proposed on the basis of structural analyses.
14674682 GPD1 has a role in increased triacylglycerol production in adipose tissue of obese humans
11822825 Identification and function of mutations in FAD-binding domain of mitochonrial glycerophosphate dehydrogenase in caucasians with type 2 diabetes mellitus.

AA Sequence

MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLP      1 - 70
PNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERL     71 - 140
GIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICGALKNVVAVG    141 - 210
AGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFART    211 - 280
GKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPEHM     281 - 349
//

Text Mined References (27)

PMID Year Title
25884759 2015 Enzyme architecture: optimization of transition state stabilization from a cation-phosphodianion pair.
24549054 2014 A compound heterozygous mutation in GPD1 causes hepatomegaly, steatohepatitis, and hypertriglyceridemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22226083 2012 Transient infantile hypertriglyceridemia, fatty liver, and hepatic fibrosis caused by mutated GPD1, encoding glycerol-3-phosphate dehydrogenase 1.
21269460 2011 Initial characterization of the human central proteome.
20404019 2010 The influence of obstructive sleep apnea on the expression of glycerol-3-phosphate dehydrogenase 1 gene.
19425502 [Colorectal cancer 2D-proteomics: identification of altered protein expression].
19296078 2009 Decreased levels of metabolic enzymes in pancreatic islets of patients with type 2 diabetes.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...