Property Summary

NCBI Gene PubMed Count 71
Grant Count 109
R01 Count 61
Funding $14,421,205.06
PubMed Score 395.23
PubTator Score 295.21

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P21673
Symbols SAT
DC21
KFSD
SSAT
KFSDX
SSAT-1

Gene

PANTHER Protein Class (2)

PDB

2B3U   2B3V   2B4B   2B4D   2B58   2B5G   2F5I   2FXF   2G3T   2JEV  

Gene RIF (55)

PMID Text
25959060 Results show low SAT1 brain expression in depressed suicides and implicate low SAT1 brain expression in major depression independent of suicide
25893668 Analysis shows a significant direct correlation between SSAT expression in Prostatic Cancer tissues and disease progression.
25849284 Data suggest that SAT1 plays role in apoptosis; overexpression of SAT1 in human embryonic kidney cell line leads to a rapid depletion of spermidine and spermine, arrest in cell growth, and mitochondria-mediated apoptosis.
25390069 Enhanced SSAT expression by proximal tubule epithelial cells leads to tubular damage, and its deficiency reduces the severity of renal I/R injury through reduction of cellular damage and modulation of the innate immune response
25277523 A role for SAT1 in homologous recombination.
24735382 In females, the TC genotype was significantly more frequent in alcohol-dependent patients than in non-alcohol-dependent psychiatric controls. No differences were found among the males.
24025154 study postulates a mechanism for SAT1 and SMOX down-regulation by post-transcriptional activity of miRNAs.
23963538 The Catabolic enzyme SSAT expression levels was up-regulated in both cell lines; however, the specific SSAT siRNA treatments prevented the EBR-induced apoptosis only in LNCaP (AR+) cells.
23903781 berberine inhibits cellular growth by affecting polyamine metabolism, in particular through the upregulation of the key catabolic enzyme, spermidine/spermine N1-acetyltransferase (SSAT).
23891576 EBV-positive Akata cells demonstrated decreased SAT1 enzyme activity concomitant with altered intracellular polyamine level.
More...

AA Sequence

MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHS      1 - 70
IVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFY     71 - 140
KRRGASDLSSEEGWRLFKIDKEYLLKMATEE                                           141 - 171
//

Text Mined References (73)

PMID Year Title
25959060 2015 Isoform-level brain expression profiling of the spermidine/spermine N1-Acetyltransferase1 (SAT1) gene in major depression and suicide.
25893668 2015 Expression of spermidine/spermine N(1) -acetyl transferase (SSAT) in human prostate tissues is related to prostate cancer progression and metastasis.
25849284 2015 Depletion of the polyamines spermidine and spermine by overexpression of spermidine/spermine N¹-acetyltransferase 1 (SAT1) leads to mitochondria-mediated apoptosis in mammalian cells.
25390069 2014 Proximal tubule epithelial cell specific ablation of the spermidine/spermine N1-acetyltransferase gene reduces the severity of renal ischemia/reperfusion injury.
25277523 2014 The polyamine catabolic enzyme SAT1 modulates tumorigenesis and radiation response in GBM.
24735382 2014 Putative association between the -1415 T/C polymorphism of spermidine/spermine N1-acetyltransferase (SSAT1) gene and alcohol use disorders in women and men.
24025154 2014 Regulatory role of miRNAs in polyamine gene expression in the prefrontal cortex of depressed suicide completers.
23963538 2014 Activation of polyamine catabolic enzymes involved in diverse responses against epibrassinolide-induced apoptosis in LNCaP and DU145 prostate cancer cell lines.
23903781 2013 Modulation of the expression of folate cycle enzymes and polyamine metabolism by berberine in cisplatin-sensitive and -resistant human ovarian cancer cells.
23891576 2013 Downregulation of the polyamine regulator spermidine/spermine N(1)-acetyltransferase by Epstein-Barr virus in a Burkitt's lymphoma cell line.
More...