Property Summary

NCBI Gene PubMed Count 76
PubMed Score 409.46
PubTator Score 295.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

Synonym

Accession P21673 Q6ICU9
Symbols SAT
DC21
KFSD
SSAT
KFSDX
SSAT-1

Gene

PDB

2B3U   2B3V   2B4B   2B4D   2B58   2B5G   2F5I   2FXF   2G3T   2JEV  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (56)

AA Sequence

MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHS      1 - 70
IVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFY     71 - 140
KRRGASDLSSEEGWRLFKIDKEYLLKMATEE                                           141 - 171
//

Text Mined References (78)

PMID Year Title