Property Summary

NCBI Gene PubMed Count 71
PubMed Score 395.23
PubTator Score 295.21

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 5.73443315670998E-22
juvenile dermatomyositis 1189 6.90375373158684E-16
malignant mesothelioma 3163 1.19334250610713E-9
Duchenne muscular dystrophy 602 1.79137055687373E-8
ovarian cancer 8492 1.0549691623793E-6
acute quadriplegic myopathy 1157 1.07935456321673E-6
medulloblastoma, large-cell 6234 1.70709492763967E-6
pituitary cancer 1972 4.0085577837218E-6
group 4 medulloblastoma 1875 1.57500283028173E-5
cystic fibrosis 1670 2.14837152890614E-5
limb girdle muscular dystrophy 2I 56 2.62817106344956E-4
dermatomyositis 967 2.88688741186773E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 5.42460917551972E-4
psoriasis 6685 7.14038470401729E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.29163696453526E-4
glioblastoma 5572 8.05525948916587E-4
fascioscapulohumeral muscular dystrophy 100 8.96570796885014E-4
subependymal giant cell astrocytoma 2287 0.00120476105837552
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00242697272584366
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00451771510013863
primary pancreatic ductal adenocarcinoma 1271 0.00467604602728203
interstitial cystitis 2299 0.00510312953163884
pancreatic cancer 2300 0.00782003279138441
Multiple Sclerosis 498 0.0148916920502036
mucosa-associated lymphoid tissue lymphoma 480 0.0212191412600053
Breast cancer 3099 0.0215510499526643
astrocytoma 1493 0.0251640043885695
Becker muscular dystrophy 187 0.0321210332075778
acute myeloid leukemia 785 0.0366151441048477
spina bifida 1064 0.0435677332899902



Accession P21673
Symbols SAT


PANTHER Protein Class (2)


2B3U   2B3V   2B4B   2B4D   2B58   2B5G   2F5I   2FXF   2G3T   2JEV  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA EggNOG
Zebrafish OMA Inparanoid

Gene RIF (53)

25959060 Results show low SAT1 brain expression in depressed suicides and implicate low SAT1 brain expression in major depression independent of suicide
25893668 Analysis shows a significant direct correlation between SSAT expression in Prostatic Cancer tissues and disease progression.
25849284 Data suggest that SAT1 plays role in apoptosis; overexpression of SAT1 in human embryonic kidney cell line leads to a rapid depletion of spermidine and spermine, arrest in cell growth, and mitochondria-mediated apoptosis.
25390069 Enhanced SSAT expression by proximal tubule epithelial cells leads to tubular damage, and its deficiency reduces the severity of renal I/R injury through reduction of cellular damage and modulation of the innate immune response
25277523 A role for SAT1 in homologous recombination.
24735382 In females, the TC genotype was significantly more frequent in alcohol-dependent patients than in non-alcohol-dependent psychiatric controls. No differences were found among the males.
24025154 study postulates a mechanism for SAT1 and SMOX down-regulation by post-transcriptional activity of miRNAs.
23963538 The Catabolic enzyme SSAT expression levels was up-regulated in both cell lines; however, the specific SSAT siRNA treatments prevented the EBR-induced apoptosis only in LNCaP (AR+) cells.
23903781 berberine inhibits cellular growth by affecting polyamine metabolism, in particular through the upregulation of the key catabolic enzyme, spermidine/spermine N1-acetyltransferase (SSAT).
23891576 EBV-positive Akata cells demonstrated decreased SAT1 enzyme activity concomitant with altered intracellular polyamine level.

AA Sequence

KRRGASDLSSEEGWRLFKIDKEYLLKMATEE                                           141 - 171

Text Mined References (73)

PMID Year Title
25959060 2015 Isoform-level brain expression profiling of the spermidine/spermine N1-Acetyltransferase1 (SAT1) gene in major depression and suicide.
25893668 2015 Expression of spermidine/spermine N(1) -acetyl transferase (SSAT) in human prostate tissues is related to prostate cancer progression and metastasis.
25849284 2015 Depletion of the polyamines spermidine and spermine by overexpression of spermidine/spermine N¹-acetyltransferase 1 (SAT1) leads to mitochondria-mediated apoptosis in mammalian cells.
25390069 2014 Proximal tubule epithelial cell specific ablation of the spermidine/spermine N1-acetyltransferase gene reduces the severity of renal ischemia/reperfusion injury.
25277523 2014 The polyamine catabolic enzyme SAT1 modulates tumorigenesis and radiation response in GBM.
24735382 2014 Putative association between the -1415 T/C polymorphism of spermidine/spermine N1-acetyltransferase (SSAT1) gene and alcohol use disorders in women and men.
24025154 2014 Regulatory role of miRNAs in polyamine gene expression in the prefrontal cortex of depressed suicide completers.
23963538 2014 Activation of polyamine catabolic enzymes involved in diverse responses against epibrassinolide-induced apoptosis in LNCaP and DU145 prostate cancer cell lines.
23903781 2013 Modulation of the expression of folate cycle enzymes and polyamine metabolism by berberine in cisplatin-sensitive and -resistant human ovarian cancer cells.
23891576 2013 Downregulation of the polyamine regulator spermidine/spermine N(1)-acetyltransferase by Epstein-Barr virus in a Burkitt's lymphoma cell line.