Property Summary

NCBI Gene PubMed Count 114
PubMed Score 696.31
PubTator Score 546.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung carcinoma 413 2.08137061216936E-13
juvenile dermatomyositis 1189 1.76747470385166E-9
lung carcinoma 2844 7.84211521560198E-9
pilocytic astrocytoma 3086 1.15884453648616E-6
Waldenstrons macroglobulinemia 765 1.62713494618336E-6
chronic lymphocytic leukemia 244 2.31602677567005E-5
primary Sjogren syndrome 789 3.06624710430528E-5
lung cancer 4473 1.00033722887704E-4
ovarian cancer 8492 1.70012799207604E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.30726461629255E-4
group 3 medulloblastoma 2254 3.22403540026525E-4
lung adenocarcinoma 2714 4.86692128368761E-4
cystic fibrosis 1670 6.04948476467765E-4
pancreatic cancer 2300 7.74310368845666E-4
tuberculosis 1563 0.00101079143903898
medulloblastoma, large-cell 6234 0.00104449886681822
posterior fossa group B ependymoma 1530 0.00131501060417111
cutaneous lupus erythematosus 1056 0.00136251785299415
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00200742669331055
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00280213202414256
psoriasis 6685 0.00292543753346609
Atopic dermatitis 944 0.00313798247412858
invasive ductal carcinoma 2950 0.00377490684768741
atypical teratoid / rhabdoid tumor 4369 0.00636192590201844
ductal carcinoma in situ 1745 0.00703086822103154
Endometriosis 535 0.0102989435137008
glioblastoma 5572 0.0185301442183247
esophageal adenocarcinoma 737 0.0195207517873976
Breast cancer 3099 0.0355700541190263
primitive neuroectodermal tumor 3031 0.0381262871825849
Barrett's esophagus 185 0.038843139440342

Expression

Synonym

Accession P21589 B3KQI8 O75520 Q5W116 5'-NT
Symbols NT
eN
NT5
NTE
eNT
CD73
E5NT
CALJA

Gene

PDB

4H1S   4H1Y   4H2B   4H2F   4H2G   4H2I  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (75)

PMID Text
26708311 CD73 promotes the growth of human colorectal cancer cells through EGFR and the b-catenin/cyclin D1 signaling pathway. CD73 may be used as a valuable biomarker of colorectal cancer.
26691441 CD73 expression was significantly correlated with the invasion into adjacent organs.
26642367 findings reveal that CD73-generated adenosine promotes epithelial integrity and suggest why loss of CD73 in endometrial cancer allows for tumor progression
26629888 The NT5E gene is involved in both intrinsic and acquired resistance to platinum-based drugs in ovarian cancer. [meta-analysis]
26363007 This study highlights a role for CD73 as a prognostic marker of patient survival and also as a candidate therapeutic target in high-grade serous ovarian cancers.
26258883 CD73 activity from any host cell type is not required for the monocyte/macrophage polarization in the peritoneum towards a pro- or an anti-inflammatory phenotype in vivo
26253870 Our study revealed that CD73 is an independent prognostic factor in prostate cancer.
26226423 role of CD73 and CD39 ectonucleotidases in T cell differentiation
26178434 report on a Chinese family with CALJA and novel compound heterozygous mutations (c.1360G>A (p.Gly454Arg) and c.1387C>T (p.Arg463X)) in NT5E
26040919 rs9444348 heterozygosity is associated with increased risk of post-traumatic epilepsy development after brain injury.
More...

AA Sequence

MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQ      1 - 70
IRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPIL     71 - 140
SANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTL    141 - 210
NVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQA    211 - 280
YAFGKYLGYLKIEFDERGNVISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSS    281 - 350
QSCRFRECNMGNLICDAMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGT    351 - 420
FDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCRVPSYDPLKMD    421 - 490
EVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDINVVSTYISKMKVIYPAVEGRIKFSTGSHCHGSFSL    491 - 560
IFLSLWAVIFVLYQ                                                            561 - 574
//

Text Mined References (118)

PMID Year Title
26708311 2016 Effects of CD73 on human colorectal cancer cell growth in vivo and in vitro.
26691441 2016 CD73 as a therapeutic target for pancreatic neuroendocrine tumor stem cells.
26642367 2016 Loss of CD73-mediated actin polymerization promotes endometrial tumor progression.
26629888 2016 A Systems Oncology Approach Identifies NT5E as a Key Metabolic Regulator in Tumor Cells and Modulator of Platinum Sensitivity.
26363007 2015 CD73 is associated with poor prognosis in high-grade serous ovarian cancer.
26258883 2015 CD73 Activity is Dispensable for the Polarization of M2 Macrophages.
26253870 2016 CD73 Expression Is an Independent Prognostic Factor in Prostate Cancer.
26226423 2015 CD73 and CD39 ectonucleotidases in T cell differentiation: Beyond immunosuppression.
26178434 2015 Calcification of joints and arteries: second report with novel NT5E mutations and expansion of the phenotype.
26040919 2015 Genetic variation in the adenosine regulatory cycle is associated with posttraumatic epilepsy development.
More...