Property Summary

NCBI Gene PubMed Count 114
Grant Count 169
R01 Count 117
Funding $17,094,246.42
PubMed Score 696.31
PubTator Score 546.46

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P21589 B3KQI8 O75520 Q5W116 5'-NT
Symbols NT
eN
NT5
NTE
eNT
CD73
E5NT
CALJA

Gene

PDB

4H1S   4H1Y   4H2B   4H2F   4H2G   4H2I  

Gene RIF (75)

PMID Text
26708311 CD73 promotes the growth of human colorectal cancer cells through EGFR and the b-catenin/cyclin D1 signaling pathway. CD73 may be used as a valuable biomarker of colorectal cancer.
26691441 CD73 expression was significantly correlated with the invasion into adjacent organs.
26642367 findings reveal that CD73-generated adenosine promotes epithelial integrity and suggest why loss of CD73 in endometrial cancer allows for tumor progression
26629888 The NT5E gene is involved in both intrinsic and acquired resistance to platinum-based drugs in ovarian cancer. [meta-analysis]
26363007 This study highlights a role for CD73 as a prognostic marker of patient survival and also as a candidate therapeutic target in high-grade serous ovarian cancers.
26258883 CD73 activity from any host cell type is not required for the monocyte/macrophage polarization in the peritoneum towards a pro- or an anti-inflammatory phenotype in vivo
26253870 Our study revealed that CD73 is an independent prognostic factor in prostate cancer.
26226423 role of CD73 and CD39 ectonucleotidases in T cell differentiation
26178434 report on a Chinese family with CALJA and novel compound heterozygous mutations (c.1360G>A (p.Gly454Arg) and c.1387C>T (p.Arg463X)) in NT5E
26040919 rs9444348 heterozygosity is associated with increased risk of post-traumatic epilepsy development after brain injury.
More...

AA Sequence

MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQ      1 - 70
IRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPIL     71 - 140
SANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTL    141 - 210
NVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQA    211 - 280
YAFGKYLGYLKIEFDERGNVISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSS    281 - 350
QSCRFRECNMGNLICDAMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGT    351 - 420
FDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCRVPSYDPLKMD    421 - 490
EVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDINVVSTYISKMKVIYPAVEGRIKFSTGSHCHGSFSL    491 - 560
IFLSLWAVIFVLYQ                                                            561 - 574
//

Text Mined References (118)

PMID Year Title
26708311 2016 Effects of CD73 on human colorectal cancer cell growth in vivo and in vitro.
26691441 2016 CD73 as a therapeutic target for pancreatic neuroendocrine tumor stem cells.
26642367 2016 Loss of CD73-mediated actin polymerization promotes endometrial tumor progression.
26629888 2016 A Systems Oncology Approach Identifies NT5E as a Key Metabolic Regulator in Tumor Cells and Modulator of Platinum Sensitivity.
26363007 2015 CD73 is associated with poor prognosis in high-grade serous ovarian cancer.
26258883 2015 CD73 Activity is Dispensable for the Polarization of M2 Macrophages.
26253870 2016 CD73 Expression Is an Independent Prognostic Factor in Prostate Cancer.
26226423 2015 CD73 and CD39 ectonucleotidases in T cell differentiation: Beyond immunosuppression.
26178434 2015 Calcification of joints and arteries: second report with novel NT5E mutations and expansion of the phenotype.
26040919 2015 Genetic variation in the adenosine regulatory cycle is associated with posttraumatic epilepsy development.
More...