Property Summary

Ligand Count 15
NCBI Gene PubMed Count 131
PubMed Score 784.50
PubTator Score 546.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (31)

Disease log2 FC p
Astrocytoma, Pilocytic 1.700 5.3e-05
Atopic dermatitis -1.100 4.4e-03
atypical teratoid / rhabdoid tumor -1.100 6.6e-04
Barrett's esophagus 1.100 3.9e-02
Breast cancer 3.100 3.6e-02
Chronic Lymphocytic Leukemia -1.903 2.3e-05
cutaneous lupus erythematosus 1.400 1.4e-03
cystic fibrosis 1.457 1.6e-05
ductal carcinoma in situ -1.300 7.3e-03
Endometriosis -1.316 1.1e-02
ependymoma -1.100 6.6e-03
esophageal adenocarcinoma 1.100 2.0e-02
glioblastoma 1.100 1.9e-02
group 3 medulloblastoma -1.200 2.3e-03
intraductal papillary-mucinous adenoma (... 3.100 2.3e-04
intraductal papillary-mucinous carcinoma... 2.800 2.8e-03
intraductal papillary-mucinous neoplasm ... 3.300 2.0e-03
invasive ductal carcinoma -1.400 1.4e-02
juvenile dermatomyositis 1.143 1.8e-09
lung adenocarcinoma 1.100 2.3e-06
lung cancer -1.600 1.0e-04
lung carcinoma -1.100 7.8e-09
medulloblastoma, large-cell -1.300 1.5e-03
non-small cell lung carcinoma 1.600 2.1e-13
ovarian cancer -2.000 9.2e-04
pancreatic cancer 1.200 7.7e-04
primary Sjogren syndrome 1.700 3.1e-05
primitive neuroectodermal tumor -1.100 2.5e-02
psoriasis -1.100 2.9e-03
tuberculosis -1.100 1.7e-03
Waldenstrons macroglobulinemia -1.942 1.6e-06

Gene RIF (92)

AA Sequence

MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQ      1 - 70
IRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPIL     71 - 140
SANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTL    141 - 210
NVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQA    211 - 280
YAFGKYLGYLKIEFDERGNVISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSS    281 - 350
QSCRFRECNMGNLICDAMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGT    351 - 420
FDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCRVPSYDPLKMD    421 - 490
EVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDINVVSTYISKMKVIYPAVEGRIKFSTGSHCHGSFSL    491 - 560
IFLSLWAVIFVLYQ                                                            561 - 574
//

Text Mined References (135)

PMID Year Title