Property Summary

NCBI Gene PubMed Count 203
Grant Count 620
R01 Count 365
Funding $63,960,409.69
PubMed Score 1644.00
PubTator Score 1924.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
psoriasis -1.300 0.000
ependymoma 1.200 0.011
cystic fibrosis 1.393 0.014
glioblastoma -1.200 0.031
medulloblastoma, large-cell -2.700 0.000
primary pancreatic ductal adenocarcinoma 1.956 0.000
ulcerative colitis -1.100 0.000
Breast cancer 3.300 0.027
group 4 medulloblastoma -1.200 0.019
subependymal giant cell astrocytoma 2.142 0.045
nasopharyngeal carcinoma 1.300 0.011
lung carcinoma -1.600 0.000
ovarian cancer -4.000 0.000
Gaucher disease type 1 -2.100 0.016
pancreatic cancer 1.500 0.001

Synonym

Accession P21583 A0AV09 A8K2Q4 B7ZLM4 Q16487 Q68DZ2 Q7M4N8 Q9UQK7
Symbols SF
MGF
SCF
DCUA
FPH2
FPHH
KL-1
Kitl
SHEP7
DFNA69

Gene

PDB

1EXZ   1SCF   2E9W  

Gene RIF (157)

PMID Text
26704889 results suggested the existence of E2F1-miR-34c-SCF negative feedback loop which was interrupted by the hyper-methylation of miR-34c promoter in CRC cells and increased cell proliferation.
26522471 Allelic Mutations of KITLG, Encoding KIT Ligand, Cause Asymmetric and Unilateral Hearing Loss and Waardenburg Syndrome Type 2.
26188365 Na+/H+ antiporter inhibition induces cell death in TF-1 erythroleukemia cells stimulated by the stem cell factor
26179221 We identified a new heterozygous missense mutation in two families with hyper- and hypopigmentation disorders (p.Thr34Asn and p.Val37Gly, respectively). Of the six affected individuals examined by us, two had cancer.
26177551 IL-7 and SCF are elevated for a prolonged period after double umbilical cord blood transplantation and persistently high levels of these cytokines may correlate with worse clinical outcomes.
26049754 Foxc1 is essential for progenitor cell development and maintenance of bone marrow niches for these cells upregulating CXCL12 and SCF expression and inhibiting of adipogenic processes in cell progenitors. (Review)
26026391 KIT and KITLG are expressed by a subset of human colon tumors. KIT signaling promotes growth of colon cancer cells and organoids in culture and xenograft tumors in mice via its ligand, KITLG, in an autocrine or paracrine manner.
25962936 Paracrine signaling from SCF to KIT, between differentiated tumor cells and undifferentiated stem-like tumor cells, helps maintain the stem-like features of tumor cells, predominantly under conditions of hypoxia.
25799412 Results identified SCF as a direct target of HIF-1 in pancreatic cancer. SCF/c-kit promoted invasion and proliferation of pancreatic cancer cells and may be a new target for the treatment of pancreatic cancer.
25766327 we found that Kl treatment impairs Nodal mRNA expression and Fgf9-mediated Nanos2 induction, reinforcing the antagonistic effect of these two growth factors on the meiotic fate of male germ cells
More...

AA Sequence

MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWI      1 - 70
SEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEF     71 - 140
FRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGD    141 - 210
SSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV           211 - 273
//

Text Mined References (206)

PMID Year Title
26704889 2015 Interrupted E2F1-miR-34c-SCF negative feedback loop by hyper-methylation promotes colorectal cancer cell proliferation.
26522471 2015 Allelic Mutations of KITLG, Encoding KIT Ligand, Cause Asymmetric and Unilateral Hearing Loss and Waardenburg Syndrome Type 2.
26188365 2015 Inhibition of the Na+/H+ antiporter induces cell death in TF-1 erythroleukemia cells stimulated by the stem cell factor.
26179221 2015 Familial progressive hyper- and hypopigmentation and malignancy in two families with new mutations in KITLG.
26177551 2015 IL-7 and SCF Levels Inversely Correlate with T Cell Reconstitution and Clinical Outcomes after Cord Blood Transplantation in Adults.
26049754 2015 The critical and specific transcriptional regulator of the microenvironmental niche for hematopoietic stem and progenitor cells.
26026391 2015 KIT Signaling Promotes Growth of Colon Xenograft Tumors in Mice and Is Up-Regulated in a Subset of Human Colon Cancers.
25962936 2015 Maintenance of Clonogenic KIT(+) Human Colon Tumor Cells Requires Secretion of Stem Cell Factor by Differentiated Tumor Cells.
25799412 2015 SCF, regulated by HIF-1?, promotes pancreatic ductal adenocarcinoma cell progression.
25766327 2015 Fgf9 inhibition of meiotic differentiation in spermatogonia is mediated by Erk-dependent activation of Nodal-Smad2/3 signaling and is antagonized by Kit Ligand.
More...