Property Summary

NCBI Gene PubMed Count 216
PubMed Score 1697.00
PubTator Score 1924.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Peripheral vascular disease 87 0.0 3.0
Testicular cancer 25 0.0 3.0
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 0.0 4.0

Expression

  Differential Expression (16)

Disease log2 FC p
active ulcerative colitis -1.017 2.8e-02
Breast cancer 3.300 2.7e-02
cystic fibrosis 1.045 1.7e-02
ependymoma 1.200 1.1e-02
Gaucher disease type 1 -1.600 1.2e-02
glioblastoma -1.200 3.1e-02
group 4 medulloblastoma -1.200 1.9e-02
lung carcinoma -1.600 1.8e-13
malignant mesothelioma -1.200 1.8e-04
medulloblastoma, large-cell -2.700 4.4e-05
nasopharyngeal carcinoma 1.300 1.1e-02
ovarian cancer -4.000 3.6e-09
pancreatic cancer 1.500 7.6e-04
pancreatic ductal adenocarcinoma liver m... 1.916 4.2e-02
psoriasis -1.300 4.0e-04
subependymal giant cell astrocytoma 2.142 4.5e-02

Protein-protein Interaction (3)

Gene RIF (170)

AA Sequence

MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWI      1 - 70
SEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEF     71 - 140
FRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGD    141 - 210
SSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV           211 - 273
//

Text Mined References (219)

PMID Year Title