Property Summary

NCBI Gene PubMed Count 276
Grant Count 71
R01 Count 44
Funding $9,291,993.69
PubMed Score 236.56
PubTator Score 251.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
Rheumatoid Arthritis 1.700 0.009
psoriasis -1.700 0.000
malignant mesothelioma -3.400 0.000
esophageal adenocarcinoma 1.600 0.042
cutaneous lupus erythematosus 1.400 0.006
posterior fossa group A ependymoma 2.700 0.000
glioblastoma 2.400 0.000
cystic fibrosis 1.426 0.002
atypical teratoid/rhabdoid tumor 2.400 0.000
medulloblastoma 1.300 0.000
primitive neuroectodermal tumor 1.600 0.000
tuberculosis -1.500 0.000
pancreatic ductal adenocarcinoma liver m... 1.349 0.016
non-small cell lung cancer -1.071 0.000
lung cancer -4.800 0.000
ulcerative colitis 1.600 0.000
diabetes mellitus -1.100 0.034
interstitial cystitis 1.600 0.005
adult high grade glioma 2.300 0.000
pilocytic astrocytoma 1.800 0.000
subependymal giant cell astrocytoma 2.311 0.011
lung adenocarcinoma -1.291 0.000
lung carcinoma -3.000 0.000
spina bifida -1.900 0.030
gastric carcinoma 2.000 0.018
Bipolar Disorder 1.807 0.020
acute myeloid leukemia 2.200 0.002
ovarian cancer 2.000 0.000
pituitary cancer -1.500 0.000
chronic rhinosinusitis -1.981 0.022

Synonym

Accession P21580 B2R767 E1P588 Q2HIX9 Q5VXQ7 Q9NSR6 TNF alpha-induced protein 3
Symbols A20
AISBL
OTUD7C
TNFA1P2

Gene

PDB

3OJ3   3OJ4   3VUW   3VUX   3VUY   2EQE   2EQF   2EQG   2VFJ   3DKB   3ZJD   3ZJE   3ZJF   3ZJG   4ZRH   4ZS5   5DOD  

Gene RIF (247)

PMID Text
26802121 Recruitment of A20 to the C-terminal domain of NEMO represents a novel mechanism limiting NF-kappaB activation by NEMO, and its absence results in autoinflammatory disease.
26758190 By using bioinformatics analysis tool (Targetscan), the 3' untranslated region (3'UTR) of A20 gene was found to be a target of miR-125a. The expression level of miR-125a in pancreatic cancer tissues from chemo-sensitive patients was significantly lower than that from chemo-resistant patients, and was inversely correlated with the A20 mRNA.
26738398 Data suggest that tumour necrosis factor alpha-induced protein 3 (TNFAIP3) and TNFAIP3-interacting protein 1 (TNIP1) single nucleotide polymorphisms (SNPs) confer increased risk of psoriasis in ethnic South Indian Tamils.
26724675 A20 acts as a regulator of the ectodysplasin-A1 pathway to NF-kappaB activation in primary Sjogren's syndrome salivary glands epithelial cells
26716984 There was no significant difference in PFS and OS in patients with or without A20 mutations.
26679293 downregulated expression in B-lymphocytes of patients with lymphoma in Sjogren's syndrome
26652732 we identify the single nucleotide polymorphism rs2327832 of TNFAIP3 as a possible prognostic marker for diabetes outcome in children with T1D.
26642243 Loss-of-function mutations in TNFAIP3 leading to A20 haploinsufficiency cause an early-onset autoinflammatory disease.
26598072 Studied the potential prognostic value of the TNFAIP3-SNP in esophageal cancer.
26561336 knockdown of A20 in tumor site inhibited tumor growth at least through inducing the apoptosis of MDSCs. A20 might be a potential target in anticancer therapy.
More...

AA Sequence

MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALID      1 - 70
RNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKF     71 - 140
RWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVI    141 - 210
SDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDR    211 - 280
GRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQ    281 - 350
HEYKKWQENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPK    351 - 420
LNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQ    421 - 490
HNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCH    491 - 560
QRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIE    561 - 630
YRENKHFAAASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQ    631 - 700
RRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHF    701 - 770
GNAKCNGYCNECFQFKQMYG                                                      771 - 790
//

Text Mined References (286)

PMID Year Title
27175295 2016 Novel heterozygous C243Y A20/TNFAIP3 gene mutation is responsible for chronic inflammation in autosomal-dominant Behçet's disease.
26802121 2016 Recruitment of A20 by the C-terminal domain of NEMO suppresses NF-?B activation and autoinflammatory disease.
26758190 2016 MiR-125a regulates chemo-sensitivity to gemcitabine in human pancreatic cancer cells through targeting A20.
26738398 2015 TNFAIP3 and TNIP1 polymorphisms confer psoriasis risk in South Indian Tamils.
26724675 2016 Downstream activation of NF-?B in the EDA-A1/EDAR signalling in Sjögren's syndrome and its regulation by the ubiquitin-editing enzyme A20.
26716984 2015 A20 Mutation Is Not a Prognostic Marker for Activated B-Cell-Like Diffuse Large B-Cell Lymphoma.
26679293 2016 Low Protein A20 in Minor Salivary Glands is Associated with Lymphoma in Primary Sjögren's Syndrome.
26652732 2016 A20 Inhibits ?-Cell Apoptosis by Multiple Mechanisms and Predicts Residual ?-Cell Function in Type 1 Diabetes.
26642243 2016 Loss-of-function mutations in TNFAIP3 leading to A20 haploinsufficiency cause an early-onset autoinflammatory disease.
26598072 2015 Evaluation of the germline single nucleotide polymorphism rs583522 in the TNFAIP3 gene as a prognostic marker in esophageal cancer.
More...