Property Summary

NCBI Gene PubMed Count 72
Grant Count 993
R01 Count 622
Funding $89,747,317.56
PubMed Score 445.77
PubTator Score 402.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Multiple myeloma 1.523 0.004
malignant mesothelioma -5.000 0.000
astrocytoma -5.500 0.003
ependymoma -6.400 0.002
oligodendroglioma -4.100 0.000
glioblastoma -6.600 0.000
group 4 medulloblastoma -5.400 0.000
atypical teratoid / rhabdoid tumor -4.900 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -3.300 0.007
non-small cell lung cancer 1.419 0.000
intraductal papillary-mucinous adenoma (... -1.400 0.003
lung cancer 3.600 0.000
Parkinson's disease -2.700 0.013
interstitial cystitis -2.500 0.000
adult high grade glioma -4.700 0.000
pilocytic astrocytoma -5.400 0.000
aldosterone-producing adenoma -1.446 0.018
subependymal giant cell astrocytoma -3.488 0.033
lung carcinoma 4.400 0.000
Pick disease -2.600 0.032
Breast cancer 1.200 0.028
acute myeloid leukemia -1.100 0.020
ovarian cancer -2.100 0.000

Synonym

Accession P21579 Q6AI31
Symbols P65
SYT
SVP65

Gene

PDB

2K45   2K4A   2K8M   2KI6   2LHA   2N1T   2R83   3F00   3F01   3F04   3F05   4ISQ   4V11  

Gene RIF (29)

PMID Text
27126659 One-Step reverse transcriptase real time PCR for the detection SYT-SSX transcript is feasible as an aid in confirming the diagnosis of synovial sarcoma.
27036734 These findings identify Syt1 as a novel Ca(2+)-sensitive PS1 modulator that could regulate synaptic ABETA, opening avenues for novel and selective synapse targeting therapeutic strategies.
26202220 membrane tethering by E-Syt1 (ER to PM) and by synaptotagmin (secretory vesicles to PM) undergo a similar regulation by plasma membrane lipids and cytosolic Ca(2+).
25705886 A dominant negative de novo SYT1 missense variant(I368T)altered the kinetics of synaptic vesicle endocytosis and caused an early onset dyskinetic movement disorder, severe motor delay, and profound cognitive impairment.
25233429 Data suggest that calcium-dependent phosphatidylinositol 4,5-diphosphate- (PI(4,5)P2-) binding proteins (such as SYT1, PRKCA [protein kinase C alpha], and ANXA2 [annexin A2]) interactions with membrane microdomains are tightly regulated. [REVIEW]
24505276 Whole genome analyses of a well-differentiated liposarcoma reveals novel SYT1 and DDR2 rearrangements.
24302762 Structural insights into the Ca2+ and PI(4,5)P2 binding modes of the C2 domains of rabphilin 3A and synaptotagmin 1.
23932591 Hydrophobic interactions play a key role in Syt1 binding botulinum neurotoxin DC.
23607712 synaptotagmin-1 is involved in a rapid vesicular Ca(2) sequestration through a Ca(2)/H antiport
23341457 PRIP inhibits regulated exocytosis through the interaction of its C2 domain with syntaxin 1 and SNAP-25, potentially competing with accessory proteins such as synaptotagmin I and by directly inhibiting trans-SNARE complex formation
More...

AA Sequence

MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVL      1 - 70
LVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEE     71 - 140
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQ    141 - 210
FTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFS    211 - 280
LRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPF    281 - 350
EQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV    351 - 420
KK                                                                        421 - 422
//

Text Mined References (74)

PMID Year Title
27126659 2016 Detection of SYT-SSX mutant transcripts in formalin-fixed paraffin-embedded sarcoma tissues using one-step reverse transcriptase real-time PCR.
27036734 2016 Identification of the novel activity-driven interaction between synaptotagmin 1 and presenilin 1 links calcium, synapse, and amyloid beta.
26202220 2015 Triggered Ca2+ influx is required for extended synaptotagmin 1-induced ER-plasma membrane tethering.
25705886 2015 Identification of a human synaptotagmin-1 mutation that perturbs synaptic vesicle cycling.
25233429 2014 Role of calcium in membrane interactions by PI(4,5)P?-binding proteins.
24505276 2014 Whole genome analyses of a well-differentiated liposarcoma reveals novel SYT1 and DDR2 rearrangements.
24302762 2013 Structural insights into the Ca2+ and PI(4,5)P2 binding modes of the C2 domains of rabphilin 3A and synaptotagmin 1.
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
23932591 2013 Crystal structures of botulinum neurotoxin DC in complex with its protein receptors synaptotagmin I and II.
23607712 2013 Synaptotagmin 1 is required for vesicular Ca²?/H?-antiport activity.
More...