Property Summary

NCBI Gene PubMed Count 79
PubMed Score 454.96
PubTator Score 402.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute myeloid leukemia -1.100 2.0e-02
adult high grade glioma -4.700 1.5e-06
aldosterone-producing adenoma -1.446 1.8e-02
astrocytic glioma -4.200 6.1e-03
Astrocytoma, Pilocytic -5.500 2.9e-11
atypical teratoid / rhabdoid tumor -4.900 4.6e-05
Breast cancer 1.200 2.8e-02
ependymoma -6.000 2.4e-03
glioblastoma -4.300 8.2e-08
group 3 medulloblastoma -3.400 1.3e-04
interstitial cystitis -1.400 3.4e-03
intraductal papillary-mucinous adenoma (... -1.400 3.1e-03
lung cancer 2.100 1.4e-03
lung carcinoma 4.400 1.3e-22
malignant mesothelioma -4.800 1.5e-08
medulloblastoma, large-cell -2.800 4.6e-06
Multiple myeloma 1.523 4.2e-03
non-small cell lung cancer 1.419 2.8e-11
oligodendroglioma -2.900 2.2e-02
ovarian cancer -2.100 1.7e-09
Parkinson's disease -2.700 1.3e-02
Pick disease -2.600 3.2e-02
primitive neuroectodermal tumor -3.300 6.9e-03
subependymal giant cell astrocytoma -3.488 3.3e-02

Protein-protein Interaction (12)

Gene RIF (35)

AA Sequence

MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVL      1 - 70
LVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEE     71 - 140
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQ    141 - 210
FTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFS    211 - 280
LRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPF    281 - 350
EQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV    351 - 420
KK                                                                        421 - 422
//

Text Mined References (81)

PMID Year Title