Property Summary

NCBI Gene PubMed Count 92
PubMed Score 477.54
PubTator Score 1115.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.663 1.8e-02

PDB (14)

Gene RIF (65)

AA Sequence

MASHKLLVTPPKALLKPLSIPNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDMYQIMDEIKEGIQYVFQT      1 - 70
RNPLTLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVE     71 - 140
EGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGSQKA    141 - 210
LNAPPGTSLISFSDKAKKKMYSRKTKPFSFYLDIKWLANFWGCDDQPRMYHHTIPVISLYSLRESLALIA    211 - 280
EQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGG    281 - 350
LGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHCPKKKL                                351 - 392
//

Text Mined References (100)

PMID Year Title