Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.13
PubTator Score 3.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 3.22506673609978E-22
malignant mesothelioma 3163 3.35509172325942E-7
medulloblastoma 1524 2.36938828029989E-6
atypical teratoid / rhabdoid tumor 4369 7.23656899803048E-6
psoriasis 6685 8.70018975929286E-5
medulloblastoma, large-cell 6234 3.31121250403751E-4
osteosarcoma 7933 6.01073711008257E-4
primitive neuroectodermal tumor 3031 8.22534015812984E-4
adrenocortical carcinoma 1427 8.45441921358985E-4
tuberculosis 1563 0.00126834262382206
lung cancer 4473 0.0031119762468692
cutaneous lupus erythematosus 1056 0.0144105383931904

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -2.200 0.000
cutaneous lupus erythematosus -1.100 0.014
psoriasis -2.000 0.000
osteosarcoma -1.184 0.001
atypical teratoid / rhabdoid tumor 1.100 0.000
medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.100 0.000
primitive neuroectodermal tumor 1.100 0.001
adrenocortical carcinoma -1.071 0.001
tuberculosis -1.500 0.001
lung cancer -1.200 0.003
lung carcinoma 1.600 0.000

Synonym

Accession P21506 B2RBS1 Q8TC91
Symbols KOX1

Gene

  Ortholog (3)

Species Source
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
26096782 results indicate that ZNF10 could be involved in a potent intrinsic antiretroviral defense
24498343 Data indicate that Xenopus laevis XFIN-AB displayed reduced potency in repression compared to human ZNF10 KRAB-AB.

AA Sequence

MDAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLGYQLTKPDVILRLEKGE      1 - 70
EPWLVEREIHQETHPDSETAFEIKSSVSSRSIFKDKQSCDIKMEGMARNDLWYLSLEEVWKCRDQLDKYQ     71 - 140
ENPERHLRQVAFTQKKVLTQERVSESGKYGGNCLLPAQLVLREYFHKRDSHTKSLKHDLVLNGHQDSCAS    141 - 210
NSNECGQTFCQNIHLIQFARTHTGDKSYKCPDNDNSLTHGSSLGISKGIHREKPYECKECGKFFSWRSNL    211 - 280
TRHQLIHTGEKPYECKECGKSFSRSSHLIGHQKTHTGEEPYECKECGKSFSWFSHLVTHQRTHTGDKLYT    281 - 350
CNQCGKSFVHSSRLIRHQRTHTGEKPYECPECGKSFRQSTHLILHQRTHVRVRPYECNECGKSYSQRSHL    351 - 420
VVHHRIHTGLKPFECKDCGKCFSRSSHLYSHQRTHTGEKPYECHDCGKSFSQSSALIVHQRIHTGEKPYE    421 - 490
CCQCGKAFIRKNDLIKHQRIHVGEETYKCNQCGIIFSQNSPFIVHQIAHTGEQFLTCNQCGTALVNTSNL    491 - 560
IGYQTNHIRENAY                                                             561 - 573
//

Text Mined References (16)

PMID Year Title
26096782 2015 ZNF10 inhibits HIV-1 LTR activity through interaction with NF-?B and Sp1 binding motifs.
24498343 2014 The B-subdomain of the Xenopus laevis XFIN KRAB-AB domain is responsible for its weaker transcriptional repressor activity compared to human ZNF10/Kox1.
23665872 2013 Novel activity of KRAB domain that functions to reinforce nuclear localization of KRAB-containing zinc finger proteins by interacting with KAP1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11405226 2001 Transcriptional repression mediated by the KRAB domain of the human C2H2 zinc finger protein Kox1/ZNF10 does not require histone deacetylation.
10748030 2000 Biochemical analysis of the Kruppel-associated box (KRAB) transcriptional repression domain.
9278146 1997 Silencing of RNA polymerases II and III-dependent transcription by the KRAB protein domain of KOX1, a Krüppel-type zinc finger factor.
More...