Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.13
PubTator Score 3.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma -1.071 8.5e-04
atypical teratoid / rhabdoid tumor 1.100 7.2e-06
cutaneous lupus erythematosus -1.100 1.4e-02
group 4 medulloblastoma 1.300 8.3e-04
lung cancer -1.200 3.1e-03
lung carcinoma 1.600 3.2e-22
malignant mesothelioma -2.200 3.4e-07
medulloblastoma, large-cell 1.100 3.3e-04
osteosarcoma -1.184 6.0e-04
primitive neuroectodermal tumor 1.100 8.2e-04
psoriasis -2.000 8.7e-05
tuberculosis -1.500 1.3e-03

Gene RIF (2)

AA Sequence

MDAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLGYQLTKPDVILRLEKGE      1 - 70
EPWLVEREIHQETHPDSETAFEIKSSVSSRSIFKDKQSCDIKMEGMARNDLWYLSLEEVWKCRDQLDKYQ     71 - 140
ENPERHLRQVAFTQKKVLTQERVSESGKYGGNCLLPAQLVLREYFHKRDSHTKSLKHDLVLNGHQDSCAS    141 - 210
NSNECGQTFCQNIHLIQFARTHTGDKSYKCPDNDNSLTHGSSLGISKGIHREKPYECKECGKFFSWRSNL    211 - 280
TRHQLIHTGEKPYECKECGKSFSRSSHLIGHQKTHTGEEPYECKECGKSFSWFSHLVTHQRTHTGDKLYT    281 - 350
CNQCGKSFVHSSRLIRHQRTHTGEKPYECPECGKSFRQSTHLILHQRTHVRVRPYECNECGKSYSQRSHL    351 - 420
VVHHRIHTGLKPFECKDCGKCFSRSSHLYSHQRTHTGEKPYECHDCGKSFSQSSALIVHQRIHTGEKPYE    421 - 490
CCQCGKAFIRKNDLIKHQRIHVGEETYKCNQCGIIFSQNSPFIVHQIAHTGEQFLTCNQCGTALVNTSNL    491 - 560
IGYQTNHIRENAY                                                             561 - 573
//

Text Mined References (16)

PMID Year Title