Property Summary

NCBI Gene PubMed Count 100
Grant Count 133
R01 Count 52
Funding $19,295,591.53
PubMed Score 515.08
PubTator Score 2628.74

Knowledge Summary

Patent (21,372)

Expression

Synonym

Accession P21462 Q14939 Q7Z6A4 Q86U52 Q9NS48 fMLP receptor
Symbols FPR
FMLP

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
362 screening 61 / 0 / 4221 Formylpeptide Receptor Ligand Binding Assay
440 screening 181 / 24 / 24099 Primary HTS Assay for Formylpeptide Receptor (FPR) Ligands and Primary HTS Counter-Screen Assay for Formylpeptide-Like-1 (FPRL1) Ligands
519 confirmatory 24 / 0 / 248 Dose Response Assay for Formylpeptide Receptor (FPR) Ligands and Dose Response Counter-Screen Assay for Formylpeptide-Like-1 (FPRL1) Ligands
699 screening 16 / 0 / 18 Secondary Calcium Response Assay for Formylpeptide Receptor (FPR) Antagonists
722 screening 38 / 0 / 1238 Formylpeptide Receptor (FPR) Ligand Structure Activity Relationship (SAR) Analysis : Primary HTS Assay
724 confirmatory 15 / 0 / 43 Formylpeptide Receptor (FPR) Ligand Structure Activity Relationship (SAR) Analysis : Dose Response Assay
762 confirmatory 0 / 0 / 15 Formylpeptide Receptor (FPRL1) Ligand Structure Activity Relationship (SAR) Analysis : FPR Dose Response Counterscreen Assay
763 screening 1 / 0 / 169 Formylpeptide Receptor-Like-1 (FPRL1) Ligand Structure Activity Relationship (SAR) Analysis : FPR Primary HTS Assay Counterscreen
805 summary 15 / 0 / 0 Assay for Formylpeptide Receptor Family Ligands: Target Formylpeptide Receptor
863 other 9 / 0 / 6 Formylpeptide Receptor (FPR) Structure Activity Relationship (SAR) Analysis: Secondary Calcium Response Assay for Antagonists

Gene RIF (78)

PMID Text
26516201 these results highlight the importance of FPR1 in chemotherapy-induced anticancer immune responses.
26071379 a pepducin designed to target FPR1 was found to hijack FPR2 and potently inhibit neutrophil functions
25529763 The authors describe here the activation of isolated human blood neutrophils by TcdB and, moreover, by toxin fragments generated by limited proteolytical digestion via the FPR1 receptor.
25277308 FPR1 rs78488639 interacted with CFH rs800292, HTRA1 rs11200638, and smoking, enhancing risk to exudative age-related macular degeneration and polypoidal choroidal vasculopathy .
25263443 Data suggest that formyl peptide receptor 1 (FPR1) stimulation may represent a novel therapeutic approach to counteract tumor angiogenesis.
25201101 the co-upregulated expression of mast cell chymase and ANXA1-FPR1 system in ectopic endometrium suggests their involvement in the development of endometriotic lesions.
25109685 FAM19A4 is a novel ligand of formyl peptide receptor 1.
25031270 These results demonstrate that a necroptosis pathway, likely mediated by annexin 1 acting through the FPR1 receptor, contributes to Stevens-Johnson syndrome (SJS) and toxic epidermal necrolysis.
24778447 cross-desensitization of CCR1 by FPR1 was associated with CCR1 phosphorylation and moderate reduction of CCR1 cell-surface expression. In contrast, CCR2 was not phosphorylated or internalized after FPR1 activation.
24778024 FPR1 expression may be used as a novel indicator to predict outcome in gastric cancer patients after gastrectomy.
More...

AA Sequence

METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVA      1 - 70
DFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVS     71 - 140
LAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGF    141 - 210
SAPMSIVAVSYGLIATKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIG    211 - 280
IAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK    281 - 350
//

Text Mined References (101)

PMID Year Title
26516201 2015 Chemotherapy-induced antitumor immunity requires formyl peptide receptor 1.
26071379 2015 A neutrophil inhibitory pepducin derived from FPR1 expected to target FPR1 signaling hijacks the closely related FPR2 instead.
25529763 2015 Human neutrophils are activated by a peptide fragment of Clostridium difficile toxin B presumably via formyl peptide receptor.
25277308 2014 FPR1 interacts with CFH, HTRA1 and smoking in exudative age-related macular degeneration and polypoidal choroidal vasculopathy.
25263443 2015 The formyl peptide receptor 1 exerts a tumor suppressor function in human gastric cancer by inhibiting angiogenesis.
25201101 2015 The intricate role of mast cell proteases and the annexin A1-FPR1 system in abdominal wall endometriosis.
25109685 2015 FAM19A4 is a novel cytokine ligand of formyl peptide receptor 1 (FPR1) and is able to promote the migration and phagocytosis of macrophages.
25031270 2014 An annexin A1-FPR1 interaction contributes to necroptosis of keratinocytes in severe cutaneous adverse drug reactions.
24778447 2014 Cross-desensitization of CCR1, but not CCR2, following activation of the formyl peptide receptor FPR1.
24778024 2014 Formyl Peptide receptor 1 expression is associated with tumor progression and survival in gastric cancer.
More...