Property Summary

NCBI Gene PubMed Count 144
Grant Count 264
R01 Count 163
Funding $21,322,003.99
PubMed Score 430.98
PubTator Score 289.22

Knowledge Summary

Patent (42,469)

Expression

  Differential Expression (17)

Synonym

Accession P21453 D3DT66 Q9BYY4 Q9NYN8 S1P receptor 1
Symbols EDG1
S1P1
CD363
ECGF1
EDG-1
CHEDG1
D1S3362

Gene

PANTHER Protein Class (2)

PDB

3V2W   3V2Y  

  TechDev Info (2)

MLP Assay (19)

AID Type Active / Inconclusive / Inactive Description
449 screening 315 / 0 / 55412 Primary HTS and Confirmation Assays for S1P1 Agonists and Agonism Potentiators
466 confirmatory 266 / 0 / 242 Dose Response Assays for S1P1 Agonists and Agonism Potentiators - Potentiator Assay 60K MLSMR
467 confirmatory 65 / 0 / 443 Dose Response Assays for S1P1 Agonists and Agonism Potentiators - Parental Cell Line Counter Screen 60K MLSMR
468 confirmatory 281 / 0 / 227 Dose Response Assays for S1P1 Agonists and Agonism Potentiators - Agonist Assay 60K MLSMR
1044 screening 243 / 0 / 15756 Primary cell-based high-throughput screening assay to identify agonists of Sphingosine 1-Phosphate receptor 1 (S1P1)
1248 confirmatory 4 / 0 / 6 Dose Response Cell-Based Assay for Agonists of the Sphingosine 1-Phosphate Receptor 1 (S1P1): Purchased Analogues
1363 confirmatory 2 / 0 / 0 Cell-membrane dose response assay to identify antagonists of the Sphingosine 1-Phosphate receptor 1 (S1P1)
1563 screening 30 / 0 / 707 Counterscreen assay for S1P4 agonists: Cell-based high throughput screening assay to identify agonists of the Sphingosine 1-Phosphate Receptor 1 (S1P1)
1564 screening 193 / 0 / 322 Counterscreen assay for S1P4 antagonists: Cell-based high throughput screening assay to identify antagonists of the Sphingosine 1-Phosphate Receptor 1 (S1P1)
1701 confirmatory 15 / 0 / 31 Fluorescence-based counterscreen assay for S1P4 agonists: Cell-based dose response high throughput screening assay to identify agonists of the Sphingosine 1-Phosphate Receptor 1 (S1P1)
More...

Gene RIF (119)

PMID Text
26824863 The results indicate that sphingosine 1-phosphate is involved in the migration of precursor T-cell lymphoblastic leukemia-lymphoma blasts in vitro, which is dependent on S1P1 expression.
26787880 multiple lines of evidence demonstrate that S1PR1 signaling sets the sensitivity of pDC amplification of IFN responses, thereby blunting pathogenic immune responses
26493335 SGPL1 ratio correlated with increased cellular sphingosine-1-phosphate (S1P), and S1P correlated with drug resistance (IC50).
26321412 Sphingosine 1-phosphate-induced IL-8 gene expression is mainly regulated via S1PR(1), and its secretion is regulated through S1PR(2) receptor subtype.
26282174 Within lymphoid follicles, the S1P1 distribution pattern is complementary to that of CCR7/CXCR4, with strong immunoreactivity tightly restricted to mantle zone B cells. This may play a role in B-cell migration toward the S1p-enriched follicle center.
26268607 the ability of ApoM(+)HDL to act as a biased agonist on S1P1 inhibits vascular inflammation, which may partially explain the cardiovascular protective functions of HDL.
26238015 S1PR1 expression was associated with unfavourable clinicopathological features and the expression of several anti-apoptosis/proliferation-related markers in urothelial carcinoma.
26197437 S1P receptor modulation reduces leukocyte migration across the endothelial barrier
26004261 Overexpression of miR148a or inhibition of S1PR1 suppressed SKOV3 cell migration and invasion, while restoration of S1PR1 expression reversed the suppressive effect of miR148a upregulation on SKOV3 cell migration and invasion.
25872153 S1P interacts with its receptors on neutrophils, resulting in NADPH oxidase activation by the PI3K-Akt cell signaling pathway and induction of the neutrophil respiratory burst.
More...

AA Sequence

MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTI      1 - 70
WKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAI     71 - 140
ERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVF    141 - 210
TLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDV    211 - 280
GCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEF    281 - 350
SRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS                                          351 - 382
//

Text Mined References (149)

PMID Year Title
26824863 2016 Sphingosine-1-Phosphate Induces Dose-Dependent Chemotaxis or Fugetaxis of T-ALL Blasts through S1P1 Activation.
26787880 2016 S1PR1-mediated IFNAR1 degradation modulates plasmacytoid dendritic cell interferon-? autoamplification.
26493335 2015 Regulation of cellular sphingosine-1-phosphate by sphingosine kinase 1 and sphingosine-1-phopshate lyase determines chemotherapy resistance in gastroesophageal cancer.
26321412 2015 Sphingosine 1-phosphate regulates IL-8 expression and secretion via S1PR1 and S1PR2 receptors-mediated signaling in extravillous trophoblast derived HTR-8/SVneo cells.
26282174 2015 Enhanced Chemokine Receptor Recycling and Impaired S1P1 Expression Promote Leukemic Cell Infiltration of Lymph Nodes in Chronic Lymphocytic Leukemia.
26268607 2015 HDL-bound sphingosine 1-phosphate acts as a biased agonist for the endothelial cell receptor S1P1 to limit vascular inflammation.
26238015 2015 Sphingosine-1-phosphate receptor 1 (S1PR1) expression in non-muscle invasive urothelial carcinoma: Association with poor clinical outcome and potential therapeutic target.
26197437 2015 Sphingosine 1 Phosphate at the Blood Brain Barrier: Can the Modulation of S1P Receptor 1 Influence the Response of Endothelial Cells and Astrocytes to Inflammatory Stimuli?
26004261 2015 MicroRNA-148a inhibits migration and invasion of ovarian cancer cells via targeting sphingosine-1-phosphate receptor 1.
25872153 2015 The Effect of Sphingosine 1-Phosphate/Sphingosine 1-Phosphate Receptor on Neutrophil Function and the Relevant Signaling Pathway.
More...