Property Summary

NCBI Gene PubMed Count 46
Grant Count 14
R01 Count 11
Funding $1,425,965.04
PubMed Score 305.57
PubTator Score 232.14

Knowledge Summary

Patent (13,616)

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
colon cancer -2.900 0.000
psoriasis -1.800 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (28)

PMID Text
26371842 Neuropeptide signaling through neurokinin-1 and neurokinin-2 receptors augments antigen presentation by human dendritic cells
23142211 The occurrence of a profound alteration in NK receptor expression in RMDD is a novel finding that suggests NK-1R and NK-2R pathways as possible players in major depressive disorder.
22733436 This study aims to explore the associations of polymorphisms in tachykinin, precursor 1 (TAC1), tachykinin receptor 1 (TACR1), and tachykinin receptor 2 (TACR2) genes and their interactions with the risk of colorectal cancer among Chinese population.
22474018 NK2R-dependent neuropeptide signaling regulates Ag-specific T cell responses via activation of DC function
20503287 Observational study of gene-disease association. (HuGE Navigator)
20175803 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19583679 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19375820 This study demonistrated that no association of Tachykinin receptor 2 (TACR2) polymorphisms with Alzheimer's disease.
19375820 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNY      1 - 70
FIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQ     71 - 140
PRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPL    141 - 210
AVMFVAYSVIGLTLWRRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIY    211 - 280
CHKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNR    281 - 350
CHTKETLFMAGDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI                          351 - 398
//

Text Mined References (47)

PMID Year Title
26371842 2015 Neuropeptide signaling through neurokinin-1 and neurokinin-2 receptors augments antigen presentation by human dendritic cells.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23142211 2013 Recurrent major depressive disorder: Imbalance of neurokinin (NK)-1 and NK-2 receptor expression in monocytes.
22733436 2012 Association of genetic variants in tachykinins pathway genes with colorectal cancer risk.
22474018 2012 Neuropeptide signaling activates dendritic cell-mediated type 1 immune responses through neurokinin-2 receptor.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20175803 2009 Pharmacogenetic study of the effects of NK2R G231E G>A and TBX21 H33Q C>G polymorphisms on asthma control with inhaled corticosteroid treatment.
19583679 2009 Polymorphisms in the neurokinin-2 receptor gene are associated with angiotensin-converting enzyme inhibitor-induced cough.
19375820 2011 No association of Tachykinin receptor 2 (TACR2) polymorphisms with Alzheimer's disease.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
More...