Property Summary

NCBI Gene PubMed Count 46
PubMed Score 305.57
PubTator Score 232.14

Knowledge Summary

Patent (13,616)

TINX Plot

  Disease Sources (3)

Disease Target Count
Bronchial Diseases 3
Disease Target Count P-value
psoriasis 6685 1.96664845637196E-67
colon cancer 1475 5.57155927152534E-7
Disease Target Count Z-score Confidence
Asthma 349 4.526 2.3
Irritable bowel syndrome 59 3.66 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
colon cancer -2.900 0.000
psoriasis -1.800 0.000

Synonym

Accession P21452 A8K7I1 Q4QRI5 Q8NGQ8 Q9UDE6 Q9UDE7 SKR
Symbols SKR
NK2R
NKNAR
TAC2R

Gene

PANTHER Protein Class (2)

  Ortholog (9)

  TechDev Info (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (28)

PMID Text
26371842 Neuropeptide signaling through neurokinin-1 and neurokinin-2 receptors augments antigen presentation by human dendritic cells
23142211 The occurrence of a profound alteration in NK receptor expression in RMDD is a novel finding that suggests NK-1R and NK-2R pathways as possible players in major depressive disorder.
22733436 This study aims to explore the associations of polymorphisms in tachykinin, precursor 1 (TAC1), tachykinin receptor 1 (TACR1), and tachykinin receptor 2 (TACR2) genes and their interactions with the risk of colorectal cancer among Chinese population.
22474018 NK2R-dependent neuropeptide signaling regulates Ag-specific T cell responses via activation of DC function
20503287 Observational study of gene-disease association. (HuGE Navigator)
20175803 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19583679 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19375820 This study demonistrated that no association of Tachykinin receptor 2 (TACR2) polymorphisms with Alzheimer's disease.
19375820 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNY      1 - 70
FIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQ     71 - 140
PRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPL    141 - 210
AVMFVAYSVIGLTLWRRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIY    211 - 280
CHKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNR    281 - 350
CHTKETLFMAGDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI                          351 - 398
//

Text Mined References (47)

PMID Year Title
26371842 2015 Neuropeptide signaling through neurokinin-1 and neurokinin-2 receptors augments antigen presentation by human dendritic cells.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23142211 2013 Recurrent major depressive disorder: Imbalance of neurokinin (NK)-1 and NK-2 receptor expression in monocytes.
22733436 2012 Association of genetic variants in tachykinins pathway genes with colorectal cancer risk.
22474018 2012 Neuropeptide signaling activates dendritic cell-mediated type 1 immune responses through neurokinin-2 receptor.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20175803 2009 Pharmacogenetic study of the effects of NK2R G231E G>A and TBX21 H33Q C>G polymorphisms on asthma control with inhaled corticosteroid treatment.
19583679 2009 Polymorphisms in the neurokinin-2 receptor gene are associated with angiotensin-converting enzyme inhibitor-induced cough.
19375820 2011 No association of Tachykinin receptor 2 (TACR2) polymorphisms with Alzheimer's disease.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
More...