Property Summary

Ligand Count 596
NCBI Gene PubMed Count 50
PubMed Score 318.33
PubTator Score 232.14

Knowledge Summary

Patent (13,616)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Bronchial Diseases 3 0.0 0.0
Disease Target Count P-value
psoriasis 6694 2.0e-67
colon cancer 1478 5.6e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
colon cancer -2.900 5.6e-07
psoriasis -1.800 2.0e-67

Protein-protein Interaction (1)

Gene RIF (30)

AA Sequence

MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNY      1 - 70
FIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQ     71 - 140
PRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPL    141 - 210
AVMFVAYSVIGLTLWRRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIY    211 - 280
CHKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNR    281 - 350
CHTKETLFMAGDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI                          351 - 398
//

Text Mined References (51)

PMID Year Title