Property Summary

NCBI Gene PubMed Count 70
Grant Count 124
R01 Count 96
Funding $14,931,649.63
PubMed Score 391.34
PubTator Score 213.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
osteosarcoma 1.372 0.008
adrenocortical carcinoma -1.079 0.000
pancreatic ductal adenocarcinoma liver m... -1.916 0.004
lung cancer -1.400 0.007
breast carcinoma -1.600 0.003
fibroadenoma -2.000 0.042
Breast cancer 2.300 0.028
aldosterone-producing adenoma -1.027 0.018
ductal carcinoma in situ -2.200 0.001
invasive ductal carcinoma -2.800 0.003
ovarian cancer 1.100 0.001

Synonym

Accession P21399 D3DRK7 Q14652 Q5VZA7 Aconitase
Symbols IRP1
ACONS
HEL60
IREB1
IREBP
IREBP1

Gene

PANTHER Protein Class (2)

PDB

2B3X   2B3Y  

Gene RIF (45)

PMID Text
26778000 Our results confirm the observation that mitoNEET is important in transferring the iron sulfur clusters to the cytosolic aconitase in living cells and the His-87 ligand in mitoNEET plays important role in this process.
26755275 The SNP rs7874815 in the ACO1 gene was strongly associated with survival in pancreatic cancer.
26296460 These in vitro studies suggest that human GLRX3 is important for cytosolic Fe-S protein maturation.
25727755 Data show that IRP1 suppressed TfR1/DMT1 (+IRE) expression, limited the cellular iron content and decreased lactate dehydrogenase (LDH) release induced by hypoxia.
25550467 ACO1 gene expression was positively associated with adipogenic markers in subcutaneous and visceral adipose tissue.
25144566 ACO1 genetic variation is associated with neuropathic pain and pain severity in HIV-infected patients on antiretroviral therapy
25106854 Polymer-dependent translocation of IRP-1 in Cd(2+)-exposed cells may underlie effects of Cd(2+) on iron homeostasis.
25012650 MitoNEET governs a novel trafficking pathway to rebuild an Fe-S cluster into cytosolic aconitase/IRP1.
24909164 SIRT3 overexpression decreases TfR1 expression by inhibiting IRP1 and represses proliferation in pancreatic cancer cells.
23935819 Data indicate that JTR-009, a benzimidazole, operated by preventing iron-regulatory protein-1 (IRP1) from binding to the iron-responsive element (IRE) in APP mRNA.
More...

AA Sequence

MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQ      1 - 70
HKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQ     71 - 140
KNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTM    141 - 210
IDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEF    211 - 280
FGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSITYLVQTGRDEEKLKYIKKYLQAVGMFRDFNDPS    281 - 350
QDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPEHHNDHKTFIYDNT    351 - 420
EFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTYYLQESGVMPY    421 - 490
LSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAY    491 - 560
AIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPS    561 - 630
DKLFFWNSKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRG    631 - 700
LTPREFNSYGSRRGNDAVMARGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLA    701 - 770
GKEYGAGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIP    771 - 840
ENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK                         841 - 889
//

Text Mined References (75)

PMID Year Title
26778000 2016 His-87 ligand in mitoNEET is crucial for the transfer of iron sulfur clusters from mitochondria to cytosolic aconitase.
26755275 2016 Circulating Metabolites and Survival Among Patients With Pancreatic Cancer.
26296460 2015 Human glutaredoxin 3 can bind and effectively transfer [4Fe-4S] cluster to apo-iron regulatory protein 1.
25727755 2015 Iron Regulatory Protein 1 Suppresses Hypoxia-Induced Iron Uptake Proteins Expression and Decreases Iron Levels in HepG2 Cells.
25550467 2015 Cytosolic aconitase activity sustains adipogenic capacity of adipose tissue connecting iron metabolism and adipogenesis.
25144566 2014 Genetic variation in iron metabolism is associated with neuropathic pain and pain severity in HIV-infected patients on antiretroviral therapy.
25106854 2014 Cadmium-induced aggregation of iron regulatory protein-1.
25012650 2014 The diabetes drug target MitoNEET governs a novel trafficking pathway to rebuild an Fe-S cluster into cytosolic aconitase/iron regulatory protein 1.
24909164 2015 SIRT3 regulates cellular iron metabolism and cancer growth by repressing iron regulatory protein 1.
24811271 2014 Genome-wide SNP associations with rubella-specific cytokine responses in measles-mumps-rubella vaccine recipients.
More...