Property Summary

NCBI Gene PubMed Count 506
PubMed Score 2411.25
PubTator Score 1692.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
ovarian cancer 8492 1.56556085622638E-19
lung carcinoma 2844 5.23959092733915E-17
non-small cell lung cancer 2798 3.29467901453981E-13
lung adenocarcinoma 2714 1.22198962160335E-11
psoriasis 6685 6.40518601310791E-10
malignant mesothelioma 3163 2.977344534632E-8
sonic hedgehog group medulloblastoma 1482 1.48104419638929E-7
lung cancer 4473 2.56907995693969E-7
ulcerative colitis 2087 1.18293317442349E-6
atypical teratoid/rhabdoid tumor 1095 1.38133633844996E-6
Breast cancer 3099 1.98916011378164E-6
interstitial cystitis 2299 6.61264351797598E-6
pituitary cancer 1972 2.06704927204912E-5
ductal carcinoma in situ 1745 1.0702939386667E-4
colon cancer 1475 1.17648248512207E-4
invasive ductal carcinoma 2950 3.81331379336819E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00139430251972003
breast carcinoma 1614 0.00145498690103526
pediatric high grade glioma 2712 0.00266855311806842
glioblastoma 5572 0.00426918550881892
pancreatic cancer 2300 0.0266341850407234
nephrosclerosis 329 0.027774993592683
interstitial lung disease 292 0.0381168249593211
nasopharyngeal carcinoma 1056 0.0407436690984096
facioscapulohumeral dystrophy 286 0.0422772668978019
Disease Target Count Z-score Confidence
Intellectual disability 573 3.392 1.7

Expression

  Differential Expression (26)

Disease log2 FC p
Endometriosis -1.685 0.007
nephrosclerosis -1.245 0.028
interstitial lung disease -1.100 0.038
malignant mesothelioma -5.300 0.000
psoriasis -1.500 0.000
sonic hedgehog group medulloblastoma -2.200 0.000
glioblastoma -1.500 0.004
atypical teratoid/rhabdoid tumor -2.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.859 0.001
non-small cell lung cancer -1.804 0.000
colon cancer -2.700 0.000
lung cancer -5.600 0.000
breast carcinoma -2.200 0.001
interstitial cystitis -3.300 0.000
lung adenocarcinoma -1.600 0.000
pediatric high grade glioma -1.100 0.003
nasopharyngeal carcinoma -1.200 0.041
Breast cancer -2.200 0.000
lung carcinoma -2.000 0.000
ductal carcinoma in situ -3.800 0.000
invasive ductal carcinoma -4.400 0.000
ulcerative colitis -2.200 0.000
ovarian cancer -3.500 0.000
pituitary cancer 1.100 0.000
pancreatic cancer -1.100 0.027
facioscapulohumeral dystrophy -1.400 0.042

Synonym

Accession P21397 B4DF46 Q16426
Symbols BRNRS
MAO-A

Gene

PDB

1H8Q   2BXR   2BXS   2Z5X   2Z5Y  

  Ortholog (9)

Gene RIF (584)

PMID Text
26698543 the association of SLC6A4 and MAOA genes with measures of obesity
26633268 5HTTLPR and uMAOA polymorphisms were not risk factors for depression.
26632697 There was no significant relationship between Migraine susceptibility and genetic polymorphisms of MAO-A-VNTR.
26620113 Our study substantiates the involvement of the monoamine oxidase A and 5,10-methylenetetrahydrofolate reductase polymorphisms in climacteric depression.
26546820 These findings demonstrate that regulation of monoamine levels by Mao activity in beta cells is pivotal for physiological insulin secretion and that loss of MaoB expression may contribute to the beta cell dysfunction in type 2 diabetes.
26494873 evidence of a moderating effect of the MAOA gene on antisocial outcomes in a population-based sample of young males; higher risks for antisocial outcomes were observed in males carrying the MAOA low-frequency alleles in comparison with high-frequency allele carriers for most outcomes when exposed to violence
26481676 These results indicate a possible impact of the MAOA-promotor polymorphism on the neurobiological modulation of aggressive behavior
26449393 A functional promoter polymorphism, MAOA-LPR, plays a role in determining continuity of parent-rated attention problems during adolescence
26228323 Genetic variation in MAOA was associated with the anger subscale of an aggressive behavior self report questionnaire in Pakistani men.
26196864 These data support part of our hypothesis that NHLH2 or MAO-A polymorphism is associated with sedentary behavior.
More...

AA Sequence

MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYV      1 - 70
GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKEIPT     71 - 140
DAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSV    141 - 210
TNGGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAK    211 - 280
IHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIM    281 - 350
GFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG    351 - 420
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKDVPAVEITHTF    421 - 490
WERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS                                     491 - 527
//

Text Mined References (512)

PMID Year Title
26698543 2016 Association of polymorphisms in 5-HTT (SLC6A4) and MAOA genes with measures of obesity in young adults of Portuguese origin.
26633268 2015 [Association between serotonin transporter and monoamine oxidase A gene polymorphisms and depression].
26632697 2015 Association Between Polymorphisms of DRD2, COMT, DBH, and MAO-A Genes and Migraine Susceptibility: A Meta-Analysis.
26620113 2016 The MAOA, COMT, MTHFR and ESR1 gene polymorphisms are associated with the risk of depression in menopausal women.
26546820 2015 Islet-specific monoamine oxidase A and B expression depends on MafA transcriptional activity and is compromised in type 2 diabetes.
26494873 2016 Effects of the MAOA gene and levels of exposure to violence on antisocial outcomes.
26481676 2016 MAOA-VNTR polymorphism modulates context-dependent dopamine release and aggressive behavior in males.
26449393 2015 Monoamine oxidase A polymorphism moderates stability of attention problems and susceptibility to life stress during adolescence.
26228323 2015 Monoamine Oxidase A gene polymorphisms and self reported aggressive behaviour in a Pakistani ethnic group.
26196864 2015 A Genetic Basis for Motivated Exercise.
More...