Property Summary

NCBI Gene PubMed Count 283
PubMed Score 2117.14
PubTator Score 449.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
FG syndrome 17 0.0 5.0
Intestinal pseudo-obstruction 8 0.0 5.0

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma 1.400 2.7e-03
posterior fossa group A ependymoma 2.400 9.6e-13
oligodendroglioma 1.100 2.3e-03
psoriasis -1.200 3.5e-03
glioblastoma 2.900 1.1e-06
osteosarcoma -1.043 4.9e-02
atypical teratoid / rhabdoid tumor 2.700 4.4e-08
sonic hedgehog group medulloblastoma 1.900 5.3e-06
primitive neuroectodermal tumor 1.400 5.4e-04
primary pancreatic ductal adenocarcinoma 2.086 1.2e-04
intraductal papillary-mucinous neoplasm ... -1.100 7.4e-03
colon cancer -1.100 2.1e-03
diabetes mellitus -1.300 2.7e-02
pediatric high grade glioma 2.500 4.4e-08
pilocytic astrocytoma 1.300 1.2e-04
subependymal giant cell astrocytoma 1.525 1.2e-02
lung carcinoma -2.100 3.9e-28
spina bifida 1.328 4.2e-02
gastric carcinoma 1.600 3.0e-02
acute myeloid leukemia 1.100 2.5e-02
ovarian cancer 1.800 6.0e-05
pancreatic cancer 2.100 1.3e-04

Protein-protein Interaction (7)

Gene RIF (178)

PMID Text
26742839 studies suggest that Vpu hijacks the FLNa function in the modulation of tetherin to neutralize the antiviral factor tetherin.
26733502 Filamin-A is required to mediate SSTR2 effects in pancreatic neuroendocrine tumours
26707877 Our interpretation of these contradictions is that truncation and/or mutation of RhoGDI2 perturbs its conformation to expose a site that adventitiously binds FLNA and is not a bona-fide interaction.
26572583 The function of different integrins is subjected to differential regulation by FLNa.
26554816 FLNA functions as a positive cellular transducer linking actin polymerization to MKL1-SRF activity, counteracting the known repressive complex of MKL1 and monomeric G-actin.
26552704 Extracellular sphingosine-1-phosphate activates NF-kappaB only in melanoma cells that lack FLNA.
26460884 The data suggest a molecular mechanism for direct G protein-coupled receptors -cytoskeleton coupling via filamin A.
26134617 Our results support FLNA as a new downstream effector of mTORC2 controlling GBM cell motility.
26059841 This study expands the diversity of the phenotypes associated with loss-of-function mutations in FLNA.
25899317 Frontometaphyseal dysplasia and keloid formation without normally present in this condition FLNA mutations have been described in six unrelated children patients.
25873011 Missense substitutions in FLNA were identified in four unrelated craniosynostosis patients.
25861040 FLNA anchors PC2 to the actin cytoskeleton through complex PC2-FLNA-actin to reduce degradation and increase stability, and possibly regulate PC2 function in a Ca-dependent manner.
25820619 FLNA analysis was performed by DHPLC followed by Sanger sequencing [Robertson et al., 2006]. Both sisters were heterozygous for a novel mutation, c.6611C>T in exon 41, that predicts the substitution p.Pro2204Leu within filamin repeat 20
25755106 Familial periventricular nodular heterotopia, epilepsy and Melnick-Needles Syndrome caused by a single FLNA mutation with combined gain-of-function and loss-of-function effects
25717257 FLNa showed low expression in colorectal adenocarcinoma, high correlation with the incidence and development of colorectal cancer, and was considered an indicator of prognosis.
25686753 These observations imply that other interactions apart from those mediated by the canonical repeat 24 dimerisation interface contribute to FLNA homodimerization and that mutations affecting this region of the protein can have broad phenotypic effects.
25666618 Autoinhibited filamin is refractory to phosphorylation by PKA on a known Ser(2152) site despite its consensus motif being exposed and the corresponding isolated peptide being readily phosphorylated.
25631074 Cellular biotinylated filamin A, alpha (FLNA) protein is incorporated into HIV-1 Gag virus-like particles
25496916 Cellular biotinylated filamin A, alpha (FLNA) protein is incorporated into HIV-1 Gag virus-like particles
25476896 The androgen-triggered AR/filamin A complex controls, through Rac 1, the decision of cells to halt cell cycle and migration.
25445790 FLNa is phosphorylated by Cdk1/cyclin B1 in mitosis
25355818 this study proposes that FLNA interaction with ICL3(intracellular loop) is central for endocytosis and signaling of WT and WHIM-like CXCR4 receptors.
25352621 Virus infection and RNase L activation disrupt its association with Filamin A and release RNase L to mediate its canonical nuclease-dependent antiviral activities.
25277454 Altered FLNA expression increases dendritic complexity and contributes to pathologic dendritic patterning in tuberous sclerosis.
25033545 Reviewed findings indicate that FLNA can be considered as a novel target in anti-cancer therapy.
24908328 Enhanced tumorigenesis occurs through increase in EGF-induced EGFR activation in FLNa-expressing melanoma cells.
24870795 FLNA expression was decreased in renal cell carcinoma tissue compared to normal kidney. FLNA may play important roles as a a tumor suppressor in RCC by promoting degradation of MMP-9.
24828612 FLNA is involved in SST2 stabilization and signaling in tumoral somatotrophs, playing both a structural and functional role.
24706888 Proline isomerization toggles domain 20 between two conformations; a stable cis conformation with slow unfolding, and a less stable, uninhibited conformation promoted by the trans form.
24469451 Crystal Structures of FLNa Domains 3-5 and FLNc Domains 4-5 Show a Novel Domain-Domain Organization.
24403084 a major function of FLNa in modulating ion channel abundance and membrane trafficking in neurons, thereby shaping their biophysical properties and function.
24390612 FLNA may play important roles as a negative regulator to prostate cancer PC-3 cell by promoting the degradation of MMP-9.
24243761 TGFBR1 and TGFBR2 mutations do not play a major role in isolated myxomatous valve dystrophy. Screening for FLNA mutations is recommended in familial myxomatous valvular dystrophy, particularly if X-linked inheritance is suspected.
24241900 FLNA expression decreased in gastric cancer and correlated significantly with lymph node metastasis, clinic stage, histological grade, and poor overall survival
24218340 FLNA may play important roles as a negative regulator to nasopharyngeal cancer CNE2 cell by promoting degradation of MMP-9.
24200678 FlnA mutations alter the balance between RhoA and Rac1 GTPases activities in favor of RhoA.
24120284 filamin A generates a scaffold for organizing a signaling complex that promotes E-cadherin-mediated cell-cell adhesion and keratinocyte differentiation
24089360 Grb7 protein interacts with Filamin-a, an actin-crosslinking component of the cell cytoskeleton.
24052262 data therefore reveal ubiquitin acceptor sites in FLNa and establish that ASB2alpha-mediated effects on cell spreading are due to loss of filamins.
24044920 Phosphorylation of serine 323 of ASB2 alpha by Erk kinases is critical for ASB2alpha-mediated degradation of FLNA.
23873601 This FLNA mutation, the most distal reported so far, causes in females classical XL-PNH, but in males an unusual, multi-organ phenotype, providing a unique insight into the FLNA-associated phenotypes.
23636454 These results suggest that a novel RACK1-FlnA interaction is an important regulator of CFTR surface localization.
23340249 PAK1 phosphorylates serine (Ser) 2152 of the actin-binding protein filamin A to a greater extent when PAK1 is tyrosyl phosphorylated by JAK2.
23166591 Cellular biotinylated filamin A, alpha (FLNA) protein is incorporated into HIV-1 Gag virus-like particles
23161538 filamin reduces ENaC channel function through direct interaction on the cell surface
23125841 Cellular biotinylated filamin A, alpha (FLNA) protein is incorporated into HIV-1 Gag virus-like particles
23117662 FLNA mutation heterogeneity correlates with different platelet functional impacts and points to opposite regulatory roles of FLNA in spreading and flow adhesion under shear.
23041423 The combined interactions of calponin homology domains and the IgFLNa10 repeat provide the binding strength of the whole FLNa molecule to actin filaments.
23037936 Our findings emphasize that congenital short bowel syndrome can be the presenting symptom in male patients with mutations in FLNA.
23032111 Vascular and connective tissue anomalies associated with X-linked periventricular heterotopia due to mutations in Filamin A.
23007402 EGF regulates alpha5beta1 integrin activation state in cancer cell lines through the p90RSK-dependent phosphorylation of filamin A.
22870205 CCR2B receptor in Rab5-positive vesicles moves along filamin A-positive fibers.
22802962 study indicates that filamins are important regulators of polycystin-2 channel function, and further links actin cytoskeletal dynamics to the regulation of this channel protein
22771033 Here we show that BRCA2 is a component of the midbody that is recruited through an interaction with filamin A actin-binding protein.
22740120 present a study of a mother-daughter pair who share bilateral widespread gray matter heterotopia caused by a novel mutation in FLNA and the same pattern of X-chromosome inactivation but who exhibit divergent reading and cognitive profiles
22676060 low-resolution structure of nine C-terminal domains of filamin A (peptide fragments as recombinant proteins); results suggest compact, but flexible, three-branched structure; studies include dimerization and binding of ligands (peptide fragments)
22366253 Novel FLNA mutations leading to bilateral periventricular nodular heterotopia in three unrelated patients
22334688 FLNa is involved in podosome stability and their organization as rosettes and three-dimensional podosomes in macrophages.
22307607 findings reveal an additional role for FLNA as a regulator of rRNA gene expression and have important implications for our understanding of the role of FLNA in human disease
22238415 These results demonstrate that FLNA is prone to pathogenic rearrangements
22194892 Nephrin ligation resulted in abnormal morphology of actin tails in human podocytes when Ship2, Filamin or Lamellipodin were individually knocked down.
22174152 these data demonstrate that coordinated expression of GPIbalpha and filamin is required for efficient trafficking of either protein to the cell surface, and for production of normal-sized platelets.
22076441 data highlight the critical role of FLNA in radial glia organization and function for neurogenesis and migration and also provide insight into the molecular pathogenesis of human periventricular nodular heterotopia
22004035 Cellular biotinylated filamin A, alpha (FLNA) protein is incorporated into HIV-1 Gag virus-like particles
21960593 mutations in FLNA may represent an unrecognized cause of macrothrombocytopenia with an altered platelet production and a modified platelet-vessel wall interaction
21926999 Consistent with structural predictions, strain increases beta-integrin binding to FLNA, whereas it causes FilGAP to dissociate from FLNA, providing a direct and specific molecular basis for cellular mechanotransduction
21914078 Hepatitis C virus nonstructural (NS) 3 and NS5A proteins were associated with filamin A, while core protein partially with filamin A and vimentin.
21821884 crystal structure of FlnA-Ig10 determined at 2.44 A resolution provides insight into the perturbations caused by these mutations
21815255 study reports on two brothers with X-linked cardiac valvular dystrophy and a hemizygous FLNA mutation and review previously described cases from the literature
21807941 regulates actin-linked caveolae dynamics following loss of cell adhesion
21773876 Review: describe the genetic, echocardiographic and functional aspects of the filamin-A-related myxomatous mitral valve dystrophy.
21705339 filamin A is involved in the distinct step of the Gag trafficking pathway.
21705339 Cellular biotinylated filamin A, alpha (FLNA) protein is incorporated into HIV-1 Gag virus-like particles
21660952 Maintaining endothelial barrier function is dependent upon active R-Ras and association between R-Ras and FLNa.
21566085 Adapter protein SH2B1beta binds filamin A to regulate prolactin-dependent cytoskeletal reorganization and cell motility
21524097 filamin is mechanically stretched by integrin or migfilin via a multisite binding mechanism for regulating cytoskeleton and integrin-mediated cell adhesion
21412975 The presence of these clinical findings in a mutation-confirmed case of OPD2 supports the notion that corneal clouding, bifid tongue, and DWM are part of the constellation of abnormalities caused by mutations in FLNA.
21359179 The extra nuclear AR/FlnA/integrin beta 1 complex is the key by which androgen activates signaling leading to cell migration. Assembly of this ternary complex may control organ development and prostate cancer metastasis.
21325883 Filamin A provides a platform for the assembly of the cyclin B1-cdk1- cdc25C complex resulting in cdk1 activation and mitotic progression.
21169733 Filamin A mutations have been identified as the cause of the most common genetic heart valvular disorder, familiar cardiac valvular dystrophy. (Review)
21156842 These outcomes suggest that the GPIbalpha-filamin A interaction not only regulates the architecture of the membrane skeleton, but also maintains the mechanical stability of the plasma membrane under conditions of high shear.
21095189 Studies indicate that interactions of filamin A with intermediate filaments and protein kinase C enable tight regulation of beta1 integrin function and consequently early events in cell adhesion and migration on extracellular matrix proteins.
21036706 Although our findings do not suggest that the expression of FLNA alone plays an independent prognostic role, the angiogenesis pathway mediated by FLNA appears to be responsible for controlling the growth of lung tumors.
20937704 FLNa down-regulation enhanced calpain activity through the mitogen-activated protein kinase-extracellular signal-regulated kinase cascade and stimulated the cleavage of FA proteins.
20847418 In transgenic mice with presenilin mutation Met146Leu, the hippocampus of the left hemisphere displays more pronounced upregulation of filamin than that of the right hemisphere.
20844545 FLNA p.V528M is neither associated with bilateral periventricular nodular heterotopia nor with thrombocytopenia and giant platelets, and represents a functional polymorphism.
20808917 FLNa as an important protein for controlling the internalization and spatial localization of the CCR2B receptor
20730588 The cardiological phenotype typically consists of aortic or mitral regurgitation, coarctation of the aorta or other left-sided cardiac malformations.
20650901 Pro-prion binds filamin A, facilitating its interaction with integrin beta1, and contributes to melanomagenesis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20598277 TOD is caused by this single recurrent mutation in the FLNA gene.
20585650 data support a model in which R-Ras functionally associates with FLNa and thereby regulates integrin-dependent migration
20473907 High FLNA is associated with tumor cell migration.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20351101 analysis of the interaction between cystic fibrosis transmembrane conductance regulator and immunoglobulin-like repeats of filamin
20351098 Cystic fibrosis transmembrane conductance regulator interacts with multiple immunoglobulin domains of filamin A
20305393 Data report the identification of the actin-binding protein Filamin A (FLNA) as BRCA1 partner and demonstrate that FLNA is required for efficient regulation of early stages of DNA repair processes.
20186808 clinical manifestations and results of FLNA exon 22 mutation screening in two boys with the perinatally lethal form of Melnick-Needles syndrome and their affected mothers
20171211 the binding of filamin A to vimentin and protein kinase C epsilon is an essential regulatory step for the trafficking and activation of beta1 integrins and cell spreading on collagen
20156194 Filamin A is a scaffold protein whose function is to link MKK4 and MKK7 together and promote JNK1 activation.
20006946 We believe the results of this study implicate filamin-A as a tunable mechanosensor, where its sensitivity can be modulated by the degree of phosphorylation.
19923718 crystal structure of actin-binding domain of filamin A was solved at 3.2 A resolution.
19917821 spectrum of mutations, including novel point and missense, associated with bilateral periventricular nodular heterotopia
19913121 Observational study of gene-disease association. (HuGE Navigator)
19808958 Loss of filamin-A is associated with decreased recombinational DNA double strand break repair in melanoma and breast cancer.
19776392 Filamin A associates with vimentin and protein kinase C-epsilon, thereby enabling vimentin phosphorylation, which is important for beta1 integrin activation and cell spreading on collagen.
19773341 These data provide the first biochemical evidence for a gain-of-function mechanism for the otopalatodigital syndrome due to filamin A mutations.
19759182 Data suggest that filamin A association with caveolin-1 promotes caveolae-mediated transport by regulating vesicle internalization, clustering, and trafficking.
19699211 Mechanical force applied to filamin can expose cryptic integrin binding sites.
19690385 propose that binding of pro-PrP to FLNa perturbs FLNa function, thus contributing to the aggressiveness of pancreatic ductal adenocarcinoma
19594548 High plasma filamin A is associated with high-grade astrocytoma and metastatic breast cancer.
19514078 Study performed all-atom discrete molecular dynamics (DMD) simulations to study thermally and force-induced unfolding of filamin A; DMD allows observation of force-induced unfolding of filamin A Ig domains under physiological forces.
19458194 These findings support a role for FLNa-beta1 integrin as a mechanosensitive complex that bidirectionally senses the tension of the matrix and, in turn, regulates cellular contractility and response to this matrix tension.
19366992 Cellular biotinylated filamin A, alpha (FLNA) protein is incorporated into HIV-1 Gag virus-like particles
19293932 Mutational analysis informed by structure can generate reagents for probing specific cellular interactions of filamin A (FLNa). Disease-related FLNa mutations have demonstrable effects on FLNa function
19292868 FLNA genes in cell cycle control and lipid metabolism with dynamically regulated binding sites for sterol regulatory element-binding protein 1 and RNA polymerase II in HepG2 cells
19213840 Filamin A modulates kinase activation and intracellular trafficking of epidermal growth factor receptors in human melanoma cells.
19177143 Wnt5A activates calpain-1, leading to the cleavage of filamin A, which results in a remodeling of the cytoskeleton and an increase in melanoma cell motility
19144823 The interaction between FilGAP and FlnA plays a role in protecting cells against force-induced apoptosis.
19137608 This study reports the structure of FLNa domain 24 (FLNa24), compare the structure with FLNc24, and discuss how dimerization is formed in FLNa24.
19018795 Our report also helps define the critical region with exclusion of FLNA in the X-linked mental retardation phenotype.
19002047 role of filamin cleavage and protein tyrosine phosphorylation in shear-stress-induced platelet microparticle formation and of its suppression by the monoclonal antibody (mAb) Ib-23 directed against GPIbalpha
18829455 analysis of the migfilin-filamin interaction and competition with integrin beta 7 tails
18799729 ASB2 may regulate hematopoietic cell differentiation by modulating cell spreading and actin remodeling through targeting of filamins A and B for degradation.
18644866 Datas suggest that filamin A links sphingosine kinase 1 and sphingosine-1-phosphate receptor 1 to locally influence the dynamics of actin cytoskeletal structures at lamellipodia to promote cell movement.
18598695 These data indicate that caveolin-1 specifies filamin A as a novel target for Akt-mediated filamin A Ser-2152 phosphorylation thus mediating the effects of caveolin-1 on IGF-I-induced cancer cell migration.
18556573 Characterize a novel cell surface protein ECSM2 that regulates endothelial chemotaxis and tube formation, and interacts with filamin A.
18427995 novel mutation, c.987G-->C mutation in exon 6 of the Filamin A (FLNA) gene in the genomic DNA in bilateral periventricular nodular heterotopia
18404377 mutant FLA lacking the actin binding domain is capable of restoring almost as well as full length FLA the down-regulation of the human mu opioid receptor. Some functions of FLA do not act via the actin cytoskeleton.
18322202 Filamin A plays a pivotal role in FcgammaRI surface expression via retention of FcgammaRI from a default lysosomal pathway.
18201775 Review explores the pathogenesis of persistent periventricular nodular heterotopia with respect to filamin-A (FLNa) mutations with mouse models. [review]
18056414 A library of FLNa fragments was generated to examine their F-actin binding to define the structural properties of FLNa that enable its various functions.
17897634 in the absence of filamin A, chronic treatment with morphine, methadone or levorphanol leads to up-regulation of mu opioid receptor
17690686 analysis of filamin a IgFLN domains suggests that auto-inhibition by adjacent IgFLN domains may be a general mechanism controlling filamin-ligand interactions.
17572668 Filamin-A as an adaptor protein that links HIV-1 receptors to the actin cytoskeleton remodelling machinery, which may facilitate virus infection.
17572668 Cellular biotinylated filamin A, alpha (FLNA) protein is incorporated into HIV-1 Gag virus-like particles
17536008 Essential for both the efficient signaling and sequestration of dopamine D3 receptor.
17431908 A novel mutation, 629G>T, in FLNA that had arisen de novo in the mother lead to Otopalatodigital syndrome type 2.
17420725 FlnA restored Casodex anticaner sensitivity in C4-2 prostatic cancer cells by decreasing Akt phosphorylation.
17408621 Our results suggest a role for cyclin B1/Cdk1 in FLNa-dependent actin remodelling.
17389601 expression of FLNa regulates constitutive activation of the Ras/ERK pathway partly through a Ras-GRF1 mechanism to modulate the production of MMP-9.
17357080 Filamin A is mutated in X-linked chronic idiopathic intestinal pseudo-obstruction with central nervous system involvement.
17235394 In cells, filamin A tethered plasma membrane CFTR to the underlying actin network. This interaction stabilized CFTR at the cell surface and regulated the plasma membrane dynamics and confinement of the channel.
17190868 filamin A is the first gene known to cause isolated nonsyndromic valvular heart disease.
17060905 Data indicate that filamin A binding to CD28 is required to induce the T-cell cytoskeletal rearrangements leading to recruitment of lipid microdomains and signalling mediators into the immunological synapse.
16949617 This suggests that the titin Z2-Zis1 domain can link filamins and alpha-actinin together in the periphery of the Z-line/dense bodies in a fashion that is conserved in smooth and striated muscles.
16849481 A novel role is revealed for filamin A in the T cell receptor/CD28 signaling pathway leading to transcription factor activation and interleukin-2 production via the inducible interaction with protein kinase C theta.
16835913 Mutations in FLNA result in frontometaphyseal dysplasia and phenotypic diversity.
16611986 beta-arrestins and FLNA cooperate to regulate ERK activation and actin cytoskeleton reorganization.
16442073 A purified C-terminal region of filamin is a suitable substrate for calcineurin in vitro and in vivo
16030015 calmodulin and calcium regulate the binding of filamin A to actin filaments
15994863 familial Ehlers-Danlos syndrome and periventricular nodular heterotopia is associated with an amino acid substition sssisns FLNA.
15837785 G12, Rho, filamin-A, and the actin cytoskeleton are required for amino acid-stimulated Ca2+ oscillations produced by the Ca2+-sensing receptor
15687500 D3R, filamin A, and beta-arrestin form a signaling complex that is destabilized by agonist- or expression-mediated increases in GRK2/3 activity
15668422 3 filamin A mutations were identified in periventricular heterotopia/Ehlers-Danlos patients: a 2762 delG, a C116 point mutation causing A39G, & a 4147 delG.
15657061 Interaction with filamin A increases cellular CaR by preventing CaR degradation, thereby facilitating CaR signaling.
15459826 FLN1 mutations may have a role in periventricular heterotopia
15249610 Periventricular nodular heterotopia caused by FLN1 mutations in men has a wide clinical spectrum and is caused by different genetic mechanisms, including somatic mosaicism.
15194946 FLNA has diverse roles in embryonic, fetal and postnatal development [review]
15128042 Filamin-A interacts with c-mip/Tc-mip in a new T-cell signaling pathway.
15024089 Data provide substantial evidence that ribosomal S6 kinase (RSK) phosphorylates filamin A, and suggest a novel role for RSK in the regulation of the actin cytoskeleton.
14988809 Dual phenotype of periventricular nodular heterotopia and frontometaphyseal dysplasia in one patient is caused by two functionally different, aberrant filamin A proteins
14718723 A woman with complex partial seizures and periventricular nodular heterotopia (PNH) had an amino acid exchange, a transition of guanine to adenine at the first position of intron 13 (IVS13 + 1 G -> A) causing a splice site mutation (2022 + 1 G -> A)
14660646 filamin-A has a role in the recovery from G2 arrest and subsequent mitotic cell death after DNA damage
12923176 filamin-A was found to have no effect on Kir2.1 channel behavior but, rather, increased the number of functional channels resident within the membrane
12791664 shear-dependent VWF-induced platelet activation affects filamin A binding to GpIb-IX-V, and filamin A binding to the cytoplasmic tail of GpIbalpha regulates proaggregatory tyrosine kinase signaling.
12750292 Filamin A binding to PSMA reduces the internalization rate of PSMA and its N-acelylated-alpha linked-acidic dipeptidase activity.
12734206 Interaction of filamin A with the insulin receptor alters insulin-dependent activation of the mitogen-activated protein kinase pathway.
12704190 Filamin A was identified as a direct binding partner of protein kinase Calpha; two binding sites were identified on filamin A; a Ca2+ and phospholipid-dependent association of the regulatory domain of protein kinase C with these sites was revealed.
12682292 FLNa interfered with androgen receptor (AR) interdomain interactions and competed with the coactivator transcriptional intermediary factor 2 to specifically down-regulate AR function.
12612583 filamin A has a role in signaling pathways that mediate organogenesis in multiple systems during embryonic development
12589795 PH domain of ROCK binds to the carboxy-terminal region of filamin-A containing the last 24th repeat. ROCK co-localized with filamin-A at the protrusive cell membranes of HeLa cells.
12531889 an important role for filamin in the endocytic sorting and recycling of the internalized CTR
12324467 there is a mechanically coupled transcriptional circuit from p38 that induces filamin-A expression [filamin A]
12198493 FLNa may be essential for Pak1-induced cytoskeletal reorganization
12119179 Cellular biotinylated filamin A, alpha (FLNA) protein is incorporated into HIV-1 Gag virus-like particles
11914408 Two new pedigrees of bilateral periventricular nodular heterotopia are reported with a mutation of FLN1 and a deletion in its C-terminus causing a distal protein truncation.
11909861 Cell death and mechanoprotection by filamin a in connective tissues after challenge by applied tensile forces

AA Sequence

MSSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTD      1 - 70
LSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGL     71 - 140
IWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLC    141 - 210
PDWDSWDASKPVTNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLN    211 - 280
PKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEV    281 - 350
TGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVI    351 - 420
QDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAVGRGL    421 - 490
QPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQN    491 - 560
IGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGS    561 - 630
CDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAK    631 - 700
HGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPN    701 - 770
KVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP    771 - 840
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQ    841 - 910
FSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLG    911 - 980
EKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGV    981 - 1050
PVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDG   1051 - 1120
TCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGS   1121 - 1190
AELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC   1191 - 1260
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHS   1261 - 1330
VDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKM   1331 - 1400
SCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQS   1401 - 1470
FQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVL   1471 - 1540
PTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVP   1541 - 1610
DVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG   1611 - 1680
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQP   1681 - 1750
PLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTI   1751 - 1820
TDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNT   1821 - 1890
KDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRM   1891 - 1960
SHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHV   1961 - 2030
ASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG   2031 - 2100
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEIS   2101 - 2170
IQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHK   2171 - 2240
VRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVK   2241 - 2310
FNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYV   2311 - 2380
TEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEF   2381 - 2450
VVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR   2451 - 2520
LVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNML   2521 - 2590
LVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP                2591 - 2647
//

Text Mined References (307)

PMID Year Title
27193221 2016 Otopalatodigital spectrum disorders: refinement of the phenotypic and mutational spectrum.
26766444 2016 Endothelial RSPO3 Controls Vascular Stability and Pruning through Non-canonical WNT/Ca(2+)/NFAT Signaling.
26742839 2016 Filamin A Is Involved in HIV-1 Vpu-mediated Evasion of Host Restriction by Modulating Tetherin Expression.
26733502 2016 Filamin-A is required to mediate SST2 effects in pancreatic neuroendocrine tumours.
26707877 2016 An adventitious interaction of filamin A with RhoGDI2(Tyr153Glu).
26572583 2015 Expression of FLNa in human melanoma cells regulates the function of integrin ?1?1 and phosphorylation and localisation of PKB/AKT/ERK1/2 kinases.
26554816 2015 Filamin A interacts with the coactivator MKL1 to promote the activity of the transcription factor SRF and cell migration.
26552704 2015 Filamin A Expression Negatively Regulates Sphingosine-1-Phosphate-Induced NF-?B Activation in Melanoma Cells by Inhibition of Akt Signaling.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26460884 2015 G protein-coupled receptors directly bind filamin A with high affinity and promote filamin phosphorylation.
26134617 2015 Significance of filamin A in mTORC2 function in glioblastoma.
26059841 2016 Exon skipping causes atypical phenotypes associated with a loss-of-function mutation in FLNA by restoring its protein function.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25899317 2015 Frontometaphyseal dysplasia and keloid formation without FLNA mutations.
25873011 2015 Association of mutations in FLNA with craniosynostosis.
25861040 2015 Filamin-a increases the stability and plasma membrane expression of polycystin-2.
25820619 2015 Recurrence of frontometaphyseal dysplasia in two sisters with a mutation in FLNA and an atypical paternal phenotype: Insights into genotype-phenotype correlation.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25755106 2015 Familial periventricular nodular heterotopia, epilepsy and Melnick-Needles Syndrome caused by a single FLNA mutation with combined gain-of-function and loss-of-function effects.
25717257 2015 New cancer suppressor gene for colorectal adenocarcinoma: filamin A.
25686753 2015 Diverse phenotypic consequences of mutations affecting the C-terminus of FLNA.
25666618 2015 A mechanism of global shape-dependent recognition and phosphorylation of filamin by protein kinase A.
25476896 2014 Role of non-genomic androgen signalling in suppressing proliferation of fibroblasts and fibrosarcoma cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25445790 2015 Phosphorylation of filamin A by Cdk1 regulates filamin A localization and daughter cell separation.
25416956 2014 A proteome-scale map of the human interactome network.
25358863 2014 Amino- and carboxyl-terminal domains of Filamin-A interact with CRMP1 to mediate Sema3A signalling.
25355818 2015 Filamin A interaction with the CXCR4 third intracellular loop regulates endocytosis and signaling of WT and WHIM-like receptors.
25352621 2014 RNase L interacts with Filamin A to regulate actin dynamics and barrier function for viral entry.
25277454 2014 MEK-ERK1/2-dependent FLNA overexpression promotes abnormal dendritic patterning in tuberous sclerosis independent of mTOR.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25033545 2014 [Filamin A as a mediator of alterations in cancer cells].
24951510 2014 Functional interaction with filamin A and intracellular Ca2+ enhance the surface membrane expression of a small-conductance Ca2+-activated K+ (SK2) channel.
24908328 2014 Filamin A expression correlates with proliferation and invasive properties of human metastatic melanoma tumors: implications for survival in patients.
24870795 2014 Interactions between filamin A and MMP-9 regulate proliferation and invasion in renal cell carcinoma.
24828612 2014 Filamin A (FLNA) plays an essential role in somatostatin receptor 2 (SST2) signaling and stabilization after agonist stimulation in human and rat somatotroph tumor cells.
24706888 2014 Force-dependent isomerization kinetics of a highly conserved proline switch modulates the mechanosensing region of filamin.
24469451 2014 A novel structural unit in the N-terminal region of filamins.
24403084 2014 Filamin A promotes dynamin-dependent internalization of hyperpolarization-activated cyclic nucleotide-gated type 1 (HCN1) channels and restricts Ih in hippocampal neurons.
24390612 2014 Filamin A regulates MMP-9 expression and suppresses prostate cancer cell migration and invasion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24243761 2014 Screening of TGFBR1, TGFBR2, and FLNA in familial mitral valve prolapse.
24241900 2014 An antiproliferative gene FLNA regulates migration and invasion of gastric carcinoma cell in vitro and its clinical significance.
24218340 2014 Absent expression of FLNA is correlated with poor prognosis of nasopharyngeal cancer.
24200678 2014 Valvular dystrophy associated filamin A mutations reveal a new role of its first repeats in small-GTPase regulation.
24120284 2014 Obligatory roles of filamin A in E-cadherin-mediated cell-cell adhesion in epidermal keratinocytes.
24089360 2013 Grb7 and Filamin-a associate and are colocalized to cell membrane ruffles upon EGF stimulation.
24052262 2013 ASB2?, an E3 ubiquitin ligase specificity subunit, regulates cell spreading and triggers proteasomal degradation of filamins by targeting the filamin calponin homology 1 domain.
24044920 2013 Phosphorylation of serine 323 of ASB2? is pivotal for the targeting of filamin A to degradation.
24021649 2013 The cytoplasmic domain of neuropilin-1 regulates focal adhesion turnover.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23890175 2013 Junctional Rab13-binding protein (JRAB) regulates cell spreading via filamins.
23873601 2013 Novel no-stop FLNA mutation causes multi-organ involvement in males.
23636454 2013 RACK1 interacts with filamin-A to regulate plasma membrane levels of the cystic fibrosis transmembrane conductance regulator.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23382103 2013 Platelet proteome analysis reveals integrin-dependent aggregation defects in patients with myelodysplastic syndromes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23340249 2013 Tyrosyl phosphorylated PAK1 regulates breast cancer cell motility in response to prolactin through filamin A.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23161538 2013 Filamin interacts with epithelial sodium channel and inhibits its channel function.
23117662 2013 Heterogeneity of platelet functional alterations in patients with filamin A mutations.
23041423 2012 Electron microscopy and 3D reconstruction reveals filamin Ig domain binding to F-actin.
23037936 2013 Congenital short bowel syndrome as the presenting symptom in male patients with FLNA mutations.
23032111 2013 Vascular and connective tissue anomalies associated with X-linked periventricular heterotopia due to mutations in Filamin A.
23007402 2012 Epidermal growth factor (EGF) regulates ?5?1 integrin activation state in human cancer cell lines through the p90RSK-dependent phosphorylation of filamin A.
22870205 2012 Filamin A-hinge region 1-EGFP: a novel tool for tracking the cellular functions of filamin A in real-time.
22802962 2012 Structural interaction and functional regulation of polycystin-2 by filamin.
22771033 2012 BRCA2 localization to the midbody by filamin A regulates cep55 signaling and completion of cytokinesis.
22740120 2012 Filamin A mutation associated with normal reading skills and dyslexia in a family with periventricular heterotopia.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22676060 2012 The C-terminal rod 2 fragment of filamin A forms a compact structure that can be extended.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22366253 2012 Atypical male and female presentations of FLNA-related periventricular nodular heterotopia.
22334688 2012 Macrophage mesenchymal migration requires podosome stabilization by filamin A.
22307607 2012 Cytoskeletal protein filamin A is a nucleolar protein that suppresses ribosomal RNA gene transcription.
22238415 2012 FLNA genomic rearrangements cause periventricular nodular heterotopia.
22194892 2011 Nephrin regulates lamellipodia formation by assembling a protein complex that includes Ship2, filamin and lamellipodin.
22174152 2012 GPIb? regulates platelet size by controlling the subcellular localization of filamin.
22121117 2012 A meckelin-filamin A interaction mediates ciliogenesis.
22076441 2012 A glial origin for periventricular nodular heterotopia caused by impaired expression of Filamin-A.
21960593 2011 Thrombocytopenia resulting from mutations in filamin A can be expressed as an isolated syndrome.
21926999 2011 Mechanical strain in actin networks regulates FilGAP and integrin binding to filamin A.
21914078 2011 Association of filamin A and vimentin with hepatitis C virus proteins in infected human hepatocytes.
21821884 2011 Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens.
21815255 2011 Familial cardiac valvulopathy due to filamin A mutation.
21807941 2011 Phosphorylated filamin A regulates actin-linked caveolae dynamics.
21773876 2011 Filamin-a-related myxomatous mitral valve dystrophy: genetic, echocardiographic and functional aspects.
21705339 2011 Filamin A protein interacts with human immunodeficiency virus type 1 Gag protein and contributes to productive particle assembly.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21660952 2011 R-Ras interacts with filamin a to maintain endothelial barrier function.
21566085 2011 Adapter protein SH2B1beta binds filamin A to regulate prolactin-dependent cytoskeletal reorganization and cell motility.
21524097 2011 Evidence for multisite ligand binding and stretching of filamin by integrin and migfilin.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21412975 2011 Bifid tongue, corneal clouding, and Dandy-Walker malformation in a male infant with otopalatodigital syndrome type 2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21359179 2011 Androgen-induced cell migration: role of androgen receptor/filamin A association.
21325883 2011 Filamin A stimulates cdc25C function and promotes entry into mitosis.
21269460 2011 Initial characterization of the human central proteome.
21228480 2011 Identification of novel nuclear protein interactions with the N-terminal part of filamin A.
21169733 The filamins: organizers of cell structure and function.
21156842 2011 High shear-dependent loss of membrane integrity and defective platelet adhesion following disruption of the GPIb?-filamin interaction.
21095189 2011 Filamin A mediates interactions between cytoskeletal proteins that control cell adhesion.
21036706 2010 A positive relationship between filamin and VEGF in patients with lung cancer.
20937704 2010 Filamin A regulates focal adhesion disassembly and suppresses breast cancer cell migration and invasion.
20847418 2010 Alzheimer's disease-linked presenilin mutation (PS1M146L) induces filamin expression and ?-secretase independent redistribution.
20844545 2010 FLNA p.V528M substitution is neither associated with bilateral periventricular nodular heterotopia nor with macrothrombocytopenia.
20808917 2010 Filamin a binds to CCR2B and regulates its internalization.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
20730588 2011 Combined cardiological and neurological abnormalities due to filamin A gene mutation.
20713593 2010 A novel interaction between FlnA and Syk regulates platelet ITAM-mediated receptor signaling and function.
20650901 2010 Pro-prion binds filamin A, facilitating its interaction with integrin beta1, and contributes to melanomagenesis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20598277 2010 Terminal osseous dysplasia is caused by a single recurrent mutation in the FLNA gene.
20585650 2010 R-Ras regulates migration through an interaction with filamin A in melanoma cells.
20473907 2011 Filamin a mediates HGF/c-MET signaling in tumor cell migration.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20351101 2010 Biochemical basis of the interaction between cystic fibrosis transmembrane conductance regulator and immunoglobulin-like repeats of filamin.
20351098 2010 Cystic fibrosis transmembrane conductance regulator interacts with multiple immunoglobulin domains of filamin A.
20305393 2010 Identification of Filamin A as a BRCA1-interacting protein required for efficient DNA repair.
20236936 2010 LL5beta directs the translocation of filamin A and SHIP2 to sites of phosphatidylinositol 3,4,5-triphosphate (PtdIns(3,4,5)P3) accumulation, and PtdIns(3,4,5)P3 localization is mutually modified by co-recruited SHIP2.
20186808 2010 Mutational analysis of two boys with the severe perinatally lethal Melnick-Needles syndrome.
20171211 2010 Regulation of cell adhesion to collagen via beta1 integrins is dependent on interactions of filamin A with vimentin and protein kinase C epsilon.
20156194 2010 Filamin associates with stress signalling kinases MKK7 and MKK4 and regulates JNK activation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20006946 2009 Phosphorylation facilitates the integrin binding of filamin under force.
19946888 2010 Defining the membrane proteome of NK cells.
19923718 2009 Structure of the human filamin A actin-binding domain.
19917821 2009 Bilateral periventricular nodular heterotopia in France: frequency of mutations in FLNA, phenotypic heterogeneity and spectrum of mutations.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19828450 2009 Identification and characterization of multiple similar ligand-binding repeats in filamin: implication on filamin-mediated receptor clustering and cross-talk.
19808958 2009 The cytoskeleton protein filamin-A is required for an efficient recombinational DNA double strand break repair.
19776392 2010 Filamin A is required for vimentin-mediated cell adhesion and spreading.
19773341 2009 Skeletal dysplasias due to filamin A mutations result from a gain-of-function mechanism distinct from allelic neurological disorders.
19759182 2009 Filamin A regulates caveolae internalization and trafficking in endothelial cells.
19699211 2009 The regulation mechanism for the auto-inhibition of binding of human filamin A to integrin.
19690385 2009 Binding of pro-prion to filamin A disrupts cytoskeleton and correlates with poor prognosis in pancreatic cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19622754 2009 Atomic structures of two novel immunoglobulin-like domain pairs in the actin cross-linking protein filamin.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19594548 2009 Novel anti-filamin-A antibody detects a secreted variant of filamin-A in plasma from patients with breast carcinoma and high-grade astrocytoma.
19514078 2010 N-terminal strands of filamin Ig domains act as a conformational switch under biological forces.
19458194 2009 Filamin A-beta1 integrin complex tunes epithelial cell response to matrix tension.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19293932 2009 Molecular basis of filamin A-FilGAP interaction and its impairment in congenital disorders associated with filamin A mutations.
19292868 2009 Novel genes in cell cycle control and lipid metabolism with dynamically regulated binding sites for sterol regulatory element-binding protein 1 and RNA polymerase II in HepG2 cells detected by chromatin immunoprecipitation with microarray detection.
19213840 2009 Filamin A modulates kinase activation and intracellular trafficking of epidermal growth factor receptors in human melanoma cells.
19177143 2009 Wnt5A activates the calpain-mediated cleavage of filamin A.
19144823 2009 The role of FilGAP-filamin A interactions in mechanoprotection.
19137608 2009 Crystal structure of the dimerization domain of human filamin A.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19018795 2009 The clinical variability of the MECP2 duplication syndrome: description of two families with duplications excluding L1CAM and FLNA.
19002047 2008 Platelet microparticle suppressing antibody against GP Ibalpha acts independently of the filamin cleavage and increases protein tyrosine phosphorylation.
18829455 2008 Structural basis of the migfilin-filamin interaction and competition with integrin beta tails.
18799729 2008 ASB2 targets filamins A and B to proteasomal degradation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18644866 2008 Filamin A links sphingosine kinase 1 and sphingosine-1-phosphate receptor 1 at lamellipodia to orchestrate cell migration.
18598695 2008 Filamin A is a novel caveolin-1-dependent target in IGF-I-stimulated cancer cell migration.
18556573 2008 ECSM2, an endothelial specific filamin a binding protein that mediates chemotaxis.
18548008 2008 A B-Myb complex containing clathrin and filamin is required for mitotic spindle function.
18487259 2008 Fine expression profiling of full-length transcripts using a size-unbiased cDNA library prepared with the vector-capping method.
18427995 2008 A new missense mutation found in the FLNA gene in a family with bilateral periventricular nodular heterotopia (BPNH) alters the splicing process.
18404377 2008 Filamin A mutant lacking actin-binding domain restores mu opioid receptor regulation in melanoma cells.
18322202 2008 Filamin A stabilizes Fc gamma RI surface expression and prevents its lysosomal routing.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18201775 2008 Trouble making the first move: interpreting arrested neuronal migration in the cerebral cortex.
18177638 2008 Filamin A regulates cell spreading and survival via beta1 integrins.
18088087 2008 Phosphoproteome of resting human platelets.
18056414 2007 Structural basis of filamin A functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17897634 2007 Chronic morphine treatment up-regulates mu opioid receptor binding in cells lacking filamin A.
17690686 2007 Structure of three tandem filamin domains reveals auto-inhibition of ligand binding.
17632775 2007 Filamin A mutation is one cause of FG syndrome.
17572668 2007 Filamin-A regulates actin-dependent clustering of HIV receptors.
17536008 2007 Roles of protein kinase C and actin-binding protein 280 in the regulation of intracellular trafficking of dopamine D3 receptor.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17431908 2007 Otopalatodigital syndrome type 2 in two siblings with a novel filamin A 629G>T mutation: clinical, pathological, and molecular findings.
17420725 2007 A 90 kDa fragment of filamin A promotes Casodex-induced growth inhibition in Casodex-resistant androgen receptor positive C4-2 prostate cancer cells.
17408621 2007 Cyclin B1/Cdk1 binds and phosphorylates Filamin A and regulates its ability to cross-link actin.
17389601 2007 Filamin A-mediated down-regulation of the exchange factor Ras-GRF1 correlates with decreased matrix metalloproteinase-9 expression in human melanoma cells.
17357080 2007 Filamin A is mutated in X-linked chronic idiopathic intestinal pseudo-obstruction with central nervous system involvement.
17235394 2007 Direct interaction with filamins modulates the stability and plasma membrane expression of CFTR.
17190868 2007 Mutations in the gene encoding filamin A as a cause for familial cardiac valvular dystrophy.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17060905 2006 CD28 interaction with filamin-A controls lipid raft accumulation at the T-cell immunological synapse.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16949617 2006 Expression of distinct classes of titin isoforms in striated and smooth muscles by alternative splicing, and their conserved interaction with filamins.
16862148 2006 FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling.
16849481 2006 Filamin A is required for T cell activation mediated by protein kinase C-theta.
16835913 2006 Frontometaphyseal dysplasia: mutations in FLNA and phenotypic diversity.
16611986 2006 Cooperative regulation of extracellular signal-regulated kinase activation and cell shape change by filamin A and beta-arrestins.
16596676 2006 Genotype-epigenotype-phenotype correlations in females with frontometaphyseal dysplasia.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16482509 2006 Binding specificity of Toll-like receptor cytoplasmic domains.
16442073 2006 Calcineurin dephosphorylates the C-terminal region of filamin in an important regulatory site: a possible mechanism for filamin mobilization and cell signaling.
16299064 2006 A filamin A splice mutation resulting in a syndrome of facial dysmorphism, periventricular nodular heterotopia, and severe constipation reminiscent of cerebro-fronto-facial syndrome.
16291724 2005 CEACAM1 functionally interacts with filamin A and exerts a dual role in the regulation of cell migration.
16263121 2005 A proteomic snapshot of the human heat shock protein 90 interactome.
16106752 2005 Vector-capping: a simple method for preparing a high-quality full-length cDNA library.
16076904 2005 The Z-disc proteins myotilin and FATZ-1 interact with each other and are connected to the sarcolemma via muscle-specific filamins.
16030015 2005 Ca2+ and calmodulin regulate the binding of filamin A to actin filaments.
15994863 2006 Ehlers-Danlos syndrome and periventricular nodular heterotopia in a Spanish family with a single FLNA mutation.
15940695 2005 A novel filamin A D203Y mutation in a female patient with otopalatodigital type 1 syndrome and extremely skewed X chromosome inactivation.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15837785 2005 Amino acid-stimulated Ca2+ oscillations produced by the Ca2+-sensing receptor are mediated by a phospholipase C/inositol 1,4,5-trisphosphate-independent pathway that requires G12, Rho, filamin-A, and the actin cytoskeleton.
15772651 2005 The DNA sequence of the human X chromosome.
15687500 2005 G protein-coupled receptor kinase regulates dopamine D3 receptor signaling by modulating the stability of a receptor-filamin-beta-arrestin complex. A case of autoreceptor regulation.
15684392 2005 FOXC1 transcriptional regulatory activity is impaired by PBX1 in a filamin A-mediated manner.
15668422 2005 Filamin A mutations cause periventricular heterotopia with Ehlers-Danlos syndrome.
15657061 2005 High affinity interaction with filamin A protects against calcium-sensing receptor degradation.
15654694 2005 A novel 9 bp deletion in the filamin a gene causes an otopalatodigital-spectrum disorder with a variable, intermediate phenotype.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15459826 2004 Mosaic mutations of the FLN1 gene cause a mild phenotype in patients with periventricular heterotopia.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15249610 2004 Germline and mosaic mutations of FLN1 in men with periventricular heterotopia.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15225631 2004 Interaction of filamin A with the integrin beta 7 cytoplasmic domain: role of alternative splicing and phosphorylation.
15194946 2004 Molecular pathology of filamin A: diverse phenotypes, many functions.
15128042 2004 The Filamin-A is a partner of Tc-mip, a new adapter protein involved in c-maf-dependent Th2 signaling pathway.
15024089 2004 Ribosomal S6 kinase (RSK) regulates phosphorylation of filamin A on an important regulatory site.
14988809 2004 A dual phenotype of periventricular nodular heterotopia and frontometaphyseal dysplasia in one patient caused by a single FLNA mutation leading to two functionally different aberrant transcripts.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14718723 2004 Functional imaging in PNH caused by a new FilaminA mutation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660646 2004 Recovery from DNA damage-induced G2 arrest requires actin-binding protein filamin-A/actin-binding protein 280.
14630798 2004 Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.
14573758 2003 Interaction between the mu opioid receptor and filamin A is involved in receptor regulation and trafficking.
12923176 2003 Direct interaction between the actin-binding protein filamin-A and the inwardly rectifying potassium channel, Kir2.1.
12791664 2003 Filamin A binding to the cytoplasmic tail of glycoprotein Ibalpha regulates von Willebrand factor-induced platelet activation.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12753905 2003 The A20-binding protein ABIN-2 exerts unexpected function in mediating transcriptional coactivation.
12750292 2003 Prostate-specific membrane antigen association with filamin A modulates its internalization and NAALADase activity.
12734206 2003 Interaction of filamin A with the insulin receptor alters insulin-dependent activation of the mitogen-activated protein kinase pathway.
12704190 2003 The F-actin cross-linking and focal adhesion protein filamin A is a ligand and in vivo substrate for protein kinase C alpha.
12682292 2003 Filamin-A fragment localizes to the nucleus to regulate androgen receptor and coactivator functions.
12679033 2003 Migfilin and Mig-2 link focal adhesions to filamin and the actin cytoskeleton and function in cell shape modulation.
12612583 2003 Localized mutations in the gene encoding the cytoskeletal protein filamin A cause diverse malformations in humans.
12589795 2003 The carboxy-terminal pleckstrin homology domain of ROCK interacts with filamin-A.
12577067 2003 A proteomics strategy to elucidate functional protein-protein interactions applied to EGF signaling.
12531889 2003 Binding of filamin to the C-terminal tail of the calcitonin receptor controls recycling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12410386 2002 Bilateral periventricular nodular heterotopia due to filamin 1 gene mutation: widespread glomeruloid microvascular anomaly and dysplastic cytoarchitecture in the cerebral cortex.
12393796 2002 Filamin A and Filamin B are co-expressed within neurons during periods of neuronal migration and can physically interact.
12324467 2002 Interaction of p38 and Sp1 in a mechanical force-induced, beta 1 integrin-mediated transcriptional circuit that regulates the actin-binding protein filamin-A.
12198493 2002 Filamin is essential in actin cytoskeletal assembly mediated by p21-activated kinase 1.
12169691 2002 The von Hippel-Lindau tumor suppressor stabilizes novel plant homeodomain protein Jade-1.
12106908 2002 Leucine-rich repeat region of decorin binds to filamin-A.
12055638 2002 Filamin A-interacting protein (FILIP) regulates cortical cell migration out of the ventricular zone.
12006559 2002 Nephrocystin-conserved domains involved in targeting to epithelial cell-cell junctions, interaction with filamins, and establishing cell polarity.
11943148 2002 The actin-binding protein Filamin-A interacts with the metabotropic glutamate receptor type 7.
11914408 2002 Familial periventricular heterotopia: missense and distal truncating mutations of the FLN1 gene.
11911837 2002 Association of dopamine D(3) receptors with actin-binding protein 280 (ABP-280).
11909861 2002 Cell death and mechanoprotection by filamin a in connective tissues after challenge by applied tensile forces.
11807098 2002 Different splice variants of filamin-B affect myogenesis, subcellular distribution, and determine binding to integrin [beta] subunits.
11781567 2001 Increased filamin binding to beta-integrin cytoplasmic domains inhibits cell migration.
11739414 2001 The SH2-containing inositol polyphosphate 5-phosphatase, SHIP-2, binds filamin and regulates submembraneous actin.
11700320 2002 Interaction between platelet glycoprotein Ibalpha and filamin-1 is essential for glycoprotein Ib/IX receptor anchorage at high shear.
11602572 2001 Interaction with BRCA2 suggests a role for filamin-1 (hsFLNa) in DNA damage response.
11532987 2001 Mutations in the X-linked filamin 1 gene cause periventricular nodular heterotopia in males as well as in females.
11390380 2001 Filamin-A binds to the carboxyl-terminal tail of the calcium-sensing receptor, an interaction that participates in CaR-mediated activation of mitogen-activated protein kinase.
11390379 2001 Interaction of the calcium-sensing receptor and filamin, a potential scaffolding protein.
11336782 2001 Structural and functional aspects of filamins.
11290523 2001 Regulation of endothelial cell barrier function by calcium/calmodulin-dependent protein kinase II.
11278410 2001 Filamin associates with Smads and regulates transforming growth factor-beta signaling.
11252955 2001 Filamins as integrators of cell mechanics and signalling.
11163396 2000 Identification of actin binding protein, ABP-280, as a binding partner of human Lnk adaptor protein.
11153914 2000 Genomic structure and fine mapping of the two human filamin gene paralogues FLNB and FLNC and comparative analysis of the filamin gene family.
11146652 2000 The Rac1- and RhoG-specific GEF domain of Trio targets filamin to remodel cytoskeletal actin.
11102480 2000 Localization and enhanced current density of the Kv4.2 potassium channel by interaction with the actin-binding protein filamin.
11038172 2000 Indications for a novel muscular dystrophy pathway. gamma-filamin, the muscle-specific filamin isoform, interacts with myotilin.
10692483 2000 Modulation of dopamine D(2) receptor signaling by actin-binding protein (ABP-280).
10637311 2000 Identification of filamin as a novel ligand for caveolin-1: evidence for the organization of caveolin-1-associated membrane domains by the actin cytoskeleton.
10617615 2000 Physical and functional interaction of filamin (actin-binding protein-280) and tumor necrosis factor receptor-associated factor 2.
10051605 1999 The small GTPase RalA targets filamin to induce filopodia.
9883725 1998 Mutations in filamin 1 prevent migration of cerebral cortical neurons in human periventricular heterotopia.
9722563 1998 Filamin binds to the cytoplasmic domain of the beta1-integrin. Identification of amino acids responsible for this interaction.
9490735 1998 A role for tissue factor in cell adhesion and migration mediated by interaction with actin-binding protein 280.
9437013 1998 Interaction of presenilins with the filamin family of actin-binding proteins.
9412467 1997 Cytoskeletal protein ABP-280 directs the intracellular trafficking of furin and modulates proprotein processing in the endocytic pathway.
9006895 1997 Actin-binding protein-280 binds the stress-activated protein kinase (SAPK) activator SEK-1 and is required for tumor necrosis factor-alpha activation of SAPK in melanoma cells.
8871564 1996 The mouse poly(C)-binding protein exists in multiple isoforms and interacts with several RNA-binding proteins.
8733135 1996 Long-range sequence analysis in Xq28: thirteen known and six candidate genes in 219.4 kb of high GC DNA between the RCP/GCP and G6PD loci.
8674032 1996 Identification of a novel protein (VBP-1) binding to the von Hippel-Lindau (VHL) tumor suppressor gene product.
8609175 1996 Leukocyte adhesion to vascular endothelium induces E-selectin linkage to the actin cytoskeleton.
8406501 1993 Actin-binding protein (ABP-280) filamin gene (FLN) maps telomeric to the color vision locus (R/GCP) and centromeric to G6PD in Xq28.
8290091 1994 Periventricular heterotopia and epilepsy.
8088819 1994 The exon-intron organization of the human X-linked gene (FLN1) encoding actin-binding protein 280.
7689010 1993 Mapping of two genes encoding isoforms of the actin binding protein ABP-280, a dystrophin like protein, to Xq28 and to chromosome 7.
6457647 1981 Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.
4044584 1985 Identification of actin-binding protein as the protein linking the membrane skeleton to glycoproteins on platelet plasma membranes.
3658675 1987 RNA splice junctions of different classes of eukaryotes: sequence statistics and functional implications in gene expression.
3138234 1988 Localization of the domain of actin-binding protein that binds to membrane glycoprotein Ib and actin in human platelets.
2391361 1990 Human endothelial actin-binding protein (ABP-280, nonmuscle filamin): a molecular leaf spring.
2248958 1990 Purification of human smooth muscle filamin and characterization of structural domains and functional sites.
2177445 1990 Probes for CpG islands on the distal long arm of the human X chromosome are clustered in Xq24 and Xq28.
1833070 1991 Ligand-sensitive binding of actin-binding protein to immunoglobulin G Fc receptor I (Fc gamma RI).
1733165 1992 Tentative assignment of gene for oto-palato-digital syndrome to distal Xq (Xq26-q28).
208386 1978 Cyclic AMP-dependent phosphorylation of the actin-binding protein filamin.