Property Summary

NCBI Gene PubMed Count 283
Grant Count 524
R01 Count 299
Funding $76,306,801.31
PubMed Score 2117.14
PubTator Score 449.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (61)

Disease Z-score Confidence
Periventricular nodular heterotopia 25 6.985 3.5
Astigmatism 27 5.107 2.6
Personality disorder 25 4.111 2.1
Scabies 7 3.997 2.0
Aicardi syndrome 15 3.889 1.9
Lissencephaly 61 3.877 1.9
Foster-Kennedy syndrome 1 3.83 1.9
Cancer 2,346 3.776 1.9
Epilepsy 346 3.763 1.9
Keratoconus 47 3.539 1.8
Gastrointestinal system disease 50 3.442 1.7
Ehlers-Danlos syndrome 42 3.431 1.7
Myopia 99 3.312 1.7
Leprosy 77 3.26 1.6
tuberculosis 1,557 3.225 1.6
Primary optic atrophy 1 3.223 1.6
Senile entropion 1 3.222 1.6
Cervicitis 6 3.168 1.6
Skin disease 65 3.122 1.6
Vaginal discharge 7 3.122 1.6
Intellectual disability 573 3.015 1.5
diabetes mellitus 1,663 3.002 1.5
Carcinoma 2,147 1.0
Cardiac valvular dysplasia, X-linked 1
Congenital idiopathic intestinal pseudoo... 1 
FG SYNDROME 2 1
FG syndrome 17 5.0
Frontometaphyseal dysplasia 1
Heterotopia, Periventricular, Ehlers-Dan... 1 
Intestinal pseudo-obstruction 8 5.0
Mammary Neoplasms 410
Melnick-Needles Syndrome 1
Neuronal intestinal pseudoobstruction 1
OTOPALATODIGITAL SYNDROME, TYPE II 1
Osteochondrodysplasias 15
Oto-Palato-digital syndrome type 1 2
Otopalatodigital Spectrum Disorder 1
Periventricular Heterotopia, X-Linked 1
Phyllodes Tumor 5
Terminal Osseous Dysplasia and Pigmentar... 1 
acute myeloid leukemia 780
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
colon cancer 1,475
gastric carcinoma 832
glioblastoma 5,572
intraductal papillary-mucinous neoplasm ... 3,289 
lung carcinoma 2,844
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
psoriasis 6,685
sonic hedgehog group medulloblastoma 1,482
spina bifida 1,064
subependymal giant cell astrocytoma 2,287

Expression

Synonym

Accession P21333 E9KL45 Q5HY53 Q5HY55 Q8NF52 FLN-A
Symbols FLN
FMD
MNS
OPD
ABPX
CSBS
CVD1
FLN1
NHBP
OPD1
OPD2
XLVD
XMVD
FLN-A
ABP-280

Gene

PDB

2BRQ   2W0P   4P3W   3ISW   2MTP   2AAV   2BP3   2J3S   2JF1   2K3T   2K7P   2K7Q   2WFN   3CNK   3HOC   3HOP   3HOR   3RGH   4M9P  

Gene RIF (183)

PMID Text
26742839 studies suggest that Vpu hijacks the FLNa function in the modulation of tetherin to neutralize the antiviral factor tetherin.
26733502 Filamin-A is required to mediate SSTR2 effects in pancreatic neuroendocrine tumours
26707877 Our interpretation of these contradictions is that truncation and/or mutation of RhoGDI2 perturbs its conformation to expose a site that adventitiously binds FLNA and is not a bona-fide interaction.
26572583 The function of different integrins is subjected to differential regulation by FLNa.
26554816 FLNA functions as a positive cellular transducer linking actin polymerization to MKL1-SRF activity, counteracting the known repressive complex of MKL1 and monomeric G-actin.
26552704 Extracellular sphingosine-1-phosphate activates NF-kappaB only in melanoma cells that lack FLNA.
26460884 The data suggest a molecular mechanism for direct G protein-coupled receptors -cytoskeleton coupling via filamin A.
26134617 Our results support FLNA as a new downstream effector of mTORC2 controlling GBM cell motility.
26059841 This study expands the diversity of the phenotypes associated with loss-of-function mutations in FLNA.
25899317 Frontometaphyseal dysplasia and keloid formation without normally present in this condition FLNA mutations have been described in six unrelated children patients.
More...

AA Sequence

MSSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTD      1 - 70
LSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGL     71 - 140
IWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLC    141 - 210
PDWDSWDASKPVTNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLN    211 - 280
PKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEV    281 - 350
TGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVI    351 - 420
QDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAVGRGL    421 - 490
QPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQN    491 - 560
IGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGS    561 - 630
CDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAK    631 - 700
HGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPN    701 - 770
KVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP    771 - 840
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQ    841 - 910
FSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLG    911 - 980
EKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGV    981 - 1050
PVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDG   1051 - 1120
TCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGS   1121 - 1190
AELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC   1191 - 1260
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHS   1261 - 1330
VDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKM   1331 - 1400
SCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQS   1401 - 1470
FQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVL   1471 - 1540
PTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVP   1541 - 1610
DVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG   1611 - 1680
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQP   1681 - 1750
PLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTI   1751 - 1820
TDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNT   1821 - 1890
KDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRM   1891 - 1960
SHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHV   1961 - 2030
ASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG   2031 - 2100
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEIS   2101 - 2170
IQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHK   2171 - 2240
VRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVK   2241 - 2310
FNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYV   2311 - 2380
TEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEF   2381 - 2450
VVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR   2451 - 2520
LVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNML   2521 - 2590
LVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP                2591 - 2647
//

Text Mined References (307)

PMID Year Title
27193221 2016 Otopalatodigital spectrum disorders: refinement of the phenotypic and mutational spectrum.
26766444 2016 Endothelial RSPO3 Controls Vascular Stability and Pruning through Non-canonical WNT/Ca(2+)/NFAT Signaling.
26742839 2016 Filamin A Is Involved in HIV-1 Vpu-mediated Evasion of Host Restriction by Modulating Tetherin Expression.
26733502 2016 Filamin-A is required to mediate SST2 effects in pancreatic neuroendocrine tumours.
26707877 2016 An adventitious interaction of filamin A with RhoGDI2(Tyr153Glu).
26572583 2015 Expression of FLNa in human melanoma cells regulates the function of integrin ?1?1 and phosphorylation and localisation of PKB/AKT/ERK1/2 kinases.
26554816 2015 Filamin A interacts with the coactivator MKL1 to promote the activity of the transcription factor SRF and cell migration.
26552704 2015 Filamin A Expression Negatively Regulates Sphingosine-1-Phosphate-Induced NF-?B Activation in Melanoma Cells by Inhibition of Akt Signaling.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26460884 2015 G protein-coupled receptors directly bind filamin A with high affinity and promote filamin phosphorylation.
More...