Property Summary

NCBI Gene PubMed Count 28
PubMed Score 22.39
PubTator Score 16.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 9.88411629740235E-19
non-small cell lung cancer 2798 7.39246693226081E-17
atypical teratoid/rhabdoid tumor 1095 5.22463374905721E-12
group 4 medulloblastoma 1875 9.01038893011597E-10
lung adenocarcinoma 2714 1.18400688153167E-8
ovarian cancer 8492 1.09477081894037E-7
malignant mesothelioma 3163 9.20192600363398E-7
colon cancer 1475 2.82587632517538E-6
inflammatory breast cancer 404 4.03905138688655E-6
psoriasis 6685 4.17266674560601E-6
medulloblastoma, large-cell 6234 5.42665595279686E-6
oligodendroglioma 2849 6.17152406858308E-6
lung cancer 4473 1.1091789038124E-5
adrenocortical carcinoma 1427 2.25443501400067E-5
pediatric high grade glioma 2712 5.5917788998144E-5
pituitary cancer 1972 6.30707263660041E-5
Down syndrome 548 0.00148398286080878
pancreatic cancer 2300 0.00276096620727816
adrenocortical adenoma 134 0.0044178667480034
glioblastoma 5572 0.00479872352079897
primitive neuroectodermal tumor 3031 0.0204606791302457
Disease Target Count Z-score Confidence
Bruxism 19 3.576 1.8
Distal arthrogryposis 45 3.203 1.6

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
psoriasis -1.100 0.000
oligodendroglioma -1.100 0.000
glioblastoma -1.400 0.005
group 4 medulloblastoma -3.500 0.000
atypical teratoid/rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -1.500 0.020
adrenocortical adenoma -1.021 0.004
adrenocortical carcinoma -1.707 0.000
non-small cell lung cancer -1.001 0.000
colon cancer -2.700 0.000
lung cancer -2.800 0.000
pediatric high grade glioma -1.700 0.000
lung adenocarcinoma -1.400 0.000
inflammatory breast cancer -2.500 0.000
breast carcinoma -1.200 0.000
ovarian cancer -1.900 0.000
pituitary cancer 1.400 0.000
Down syndrome 1.200 0.001
pancreatic cancer 1.100 0.003

Synonym

Accession P21291 A8K268 Q5U0J2
Symbols CRP
CRP1
CSRP
CYRP
D1S181E
HEL-141
HEL-S-286

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (7)

PMID Text
24357092 Plasma ADMA is a useful parameter for predicting subclinical atherosclerosis, whereas homocysteine and hsCRP are not
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21882188 Results show that CRP1 is a novel TGF-beta1 regulated protein that is expressed in fibrotic lesions and may be relevant in idiopathic pulmonary fibrosis.
20415737 CRP1 expression is regulated by UVB in human keratinocytes, suggesting a role for CRP1 in the phototoxic responses of human skin.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17486081 Hypomethylation of wingless-related MMTV integration site 5A (WNT5A), S100 calcium-binding protein P (S100P) and cysteine-rich protein 1(CRIP1) was confirmed in the cancer cells by bisulfite sequencing.
17341888 Aberrant methylation of CSRP1 is associated with hepatocellular carcinoma

AA Sequence

MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKG      1 - 70
YGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWH     71 - 140
KACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE                     141 - 193
//

Text Mined References (38)

PMID Year Title
26924529 2016 Mutations in Subunits of the Activating Signal Cointegrator 1 Complex Are Associated with Prenatal Spinal Muscular Atrophy and Congenital Bone Fractures.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24357092 2015 Predictive value of plasma asymmetric dimethylarginine, homocysteine, and high-sensitive CRP levels in occult coronary artery disease: A multidetector-row computed tomography study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382103 2013 Platelet proteome analysis reveals integrin-dependent aggregation defects in patients with myelodysplastic syndromes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21882188 2012 Cysteine-rich protein 1 is regulated by transforming growth factor-?1 and expressed in lung fibrosis.
More...