Property Summary

NCBI Gene PubMed Count 28
Grant Count 16
R01 Count 7
Funding $23,785,570.4
PubMed Score 22.39
PubTator Score 16.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
psoriasis -1.100 0.000
oligodendroglioma -1.100 0.000
glioblastoma -1.400 0.005
group 4 medulloblastoma -3.500 0.000
atypical teratoid/rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -1.500 0.020
adrenocortical adenoma -1.021 0.004
adrenocortical carcinoma -1.707 0.000
non-small cell lung cancer -1.001 0.000
colon cancer -2.700 0.000
lung cancer -2.800 0.000
pediatric high grade glioma -1.700 0.000
lung adenocarcinoma -1.400 0.000
inflammatory breast cancer -2.500 0.000
breast carcinoma -1.200 0.000
ovarian cancer -1.900 0.000
pituitary cancer 1.400 0.000
Down syndrome 1.200 0.001
pancreatic cancer 1.100 0.003

Gene RIF (7)

PMID Text
24357092 Plasma ADMA is a useful parameter for predicting subclinical atherosclerosis, whereas homocysteine and hsCRP are not
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21882188 Results show that CRP1 is a novel TGF-beta1 regulated protein that is expressed in fibrotic lesions and may be relevant in idiopathic pulmonary fibrosis.
20415737 CRP1 expression is regulated by UVB in human keratinocytes, suggesting a role for CRP1 in the phototoxic responses of human skin.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17486081 Hypomethylation of wingless-related MMTV integration site 5A (WNT5A), S100 calcium-binding protein P (S100P) and cysteine-rich protein 1(CRIP1) was confirmed in the cancer cells by bisulfite sequencing.
17341888 Aberrant methylation of CSRP1 is associated with hepatocellular carcinoma

AA Sequence

MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKG      1 - 70
YGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWH     71 - 140
KACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE                     141 - 193
//

Text Mined References (38)

PMID Year Title
26924529 2016 Mutations in Subunits of the Activating Signal Cointegrator 1 Complex Are Associated with Prenatal Spinal Muscular Atrophy and Congenital Bone Fractures.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24357092 2015 Predictive value of plasma asymmetric dimethylarginine, homocysteine, and high-sensitive CRP levels in occult coronary artery disease: A multidetector-row computed tomography study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382103 2013 Platelet proteome analysis reveals integrin-dependent aggregation defects in patients with myelodysplastic syndromes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21882188 2012 Cysteine-rich protein 1 is regulated by transforming growth factor-?1 and expressed in lung fibrosis.
More...