Property Summary

NCBI Gene PubMed Count 28
PubMed Score 24.55
PubTator Score 16.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical adenoma -1.021 4.4e-03
adrenocortical carcinoma -1.707 2.3e-05
adult high grade glioma -1.500 4.0e-03
atypical teratoid / rhabdoid tumor -3.000 2.6e-07
Breast cancer -1.600 8.1e-18
breast carcinoma -1.200 9.9e-19
colon cancer -1.200 2.7e-02
Down syndrome 1.200 1.5e-03
glioblastoma -1.200 6.4e-04
group 3 medulloblastoma -2.700 7.9e-06
lung adenocarcinoma -1.400 1.2e-08
lung cancer -2.800 1.1e-05
malignant mesothelioma -1.400 9.2e-07
medulloblastoma, large-cell -3.200 5.4e-06
non-small cell lung cancer -1.001 7.4e-17
oligodendroglioma -1.100 6.2e-06
ovarian cancer -1.900 1.1e-07
pancreatic cancer 1.100 2.8e-03
pituitary cancer 1.400 6.3e-05
primitive neuroectodermal tumor -1.500 2.0e-02
psoriasis -1.100 4.2e-06

Gene RIF (7)

AA Sequence

MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKG      1 - 70
YGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWH     71 - 140
KACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE                     141 - 193
//

Text Mined References (39)

PMID Year Title