Property Summary

NCBI Gene PubMed Count 39
PubMed Score 24.13
PubTator Score 10.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cognitive disorder 50 0.0 1.1
Mental Depression 333 0.0 1.9
Disease Target Count Z-score Confidence
Pigmented villonodular synovitis 9 3.225 1.6

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.700 6.0e-03
atypical teratoid / rhabdoid tumor -1.500 1.8e-07
ependymoma -1.600 1.4e-02
glioblastoma multiforme -1.100 6.0e-18
hepatocellular carcinoma 1.300 3.2e-06
lung cancer -1.100 4.0e-02
medulloblastoma -1.100 1.8e-04
oligodendroglioma -1.200 4.8e-16
ovarian cancer -1.800 1.4e-09
pancreatic cancer 1.200 9.6e-04
pancreatic carcinoma 1.200 9.6e-04
Pick disease -1.400 3.6e-03
primitive neuroectodermal tumor -1.300 7.4e-06

Gene RIF (7)

AA Sequence

MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAE      1 - 70
IVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPID     71 - 140
RGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQA    141 - 210
GLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALT    211 - 280
TAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQ    281 - 350
IPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSN    351 - 420
QLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFERNFIAQGPYENRTVFETLDIGWQLLRIFPKE    421 - 490
MLKRIPQSTLSEFYPRDSAKH                                                     491 - 511
//

Text Mined References (41)

PMID Year Title