Property Summary

NCBI Gene PubMed Count 145
PubMed Score 93.40
PubTator Score 99.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 7.11874364312645E-25
lung carcinoma 2844 9.65420319277673E-10
malignant mesothelioma 3163 5.32289862679244E-9
ovarian cancer 8492 6.92981298801735E-8
atypical teratoid / rhabdoid tumor 4369 3.52868945203113E-7
glioblastoma 5572 1.7789355480379E-6
medulloblastoma, large-cell 6234 2.46977604746861E-6
sonic hedgehog group medulloblastoma 1482 2.75904804806042E-6
pediatric high grade glioma 2712 5.52498048867459E-6
primitive neuroectodermal tumor 3031 2.96958520444584E-5
Breast cancer 3099 6.09115968468074E-5
sarcoidosis 368 6.92379789562723E-5
ulcerative colitis 2087 0.00121983478885745
osteosarcoma 7933 0.00149781787299167
tuberculosis and treatment for 3 months 327 0.00231958110224387
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00273506400420912
acute myeloid leukemia 785 0.00344309089376096
invasive ductal carcinoma 2950 0.0039590722333219
head and neck cancer 270 0.00778599444928231
fibroadenoma 557 0.0131505782185848
colon cancer 1475 0.0174984403270255
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0224663293005844
diabetes mellitus 1663 0.0320681240226714
Disease Target Count Z-score Confidence
Cancer 2346 3.81 1.9

Expression

  Differential Expression (23)

Synonym

Accession P21266 O60550 Q96HA3
Symbols GST5
GSTB
GTM3
GSTM3-3

Gene

PDB

3GTU  

  Ortholog (7)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (138)

PMID Text
26125851 No associations between the GSTT1, GSTP1, and GSTM3 genotypes and neoplasia risk were observed. In conclusion, we determined the genotype distribution of GST polymorphisms in control subjects and breast cancer patients from northeastern Mexico.
25193115 NSD1 interacted with RNAPII and bound to GSTM3 -63A/C TATA box.
25040976 To identify the genotypes of CYP1A1, GSTM1, GSTM3, GSTT1 and GSTP1 in a case-control study.
24689813 This meta-analysis suggested that the GSTT1 and GSTM3 polymorphisms might influence osteosarcoma risk.
24416175 This meta-analysis suggests that the GSTM3 A/B polymorphism may be an important protective factor for head and neck cancer, especially of laryngeal cancer and Caucasian populations.
24157827 rs1332018 genetic variants in the GSTM3 promoter predispose the host to downregulating GSTM3 expression in kidney, facilitate carcinogenesis, and predict an unfavourable postoperative prognosis of renal cell carcinoma.
23167362 The GSTM3 A/B gene polymorphism is not associated with lung cancer susceptibility.
23036584 In conclusion, this epistatic interaction showed a high degree of consistency when stratifying by sex, the epsilon4 allele of apolipoprotein E genotype, and geographic region.
22976281 Methylation of GSTM3 promoter may contribute to oxidative stress-associated liver damage and correlate with the disease severity in Acute-on-chronic hepatitis B liver failure.
22430872 All three markers correlated significantly with regional lymph node metastasis: FXYD3 (p = 0.0110), S100A11 (p = 0.0071), and GSTM3 (p = 0.0173) in colon cancer lymphatic metastasis.
More...

AA Sequence

MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDG      1 - 70
KNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLK     71 - 140
QFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKM    141 - 210
PINNKMAQWGNKPVC                                                           211 - 225
//

Text Mined References (146)

PMID Year Title
26125851 2015 Polymorphisms in GSTM1, GSTT1, GSTP1, and GSTM3 genes and breast cancer risk in northeastern Mexico.
25193115 2014 Role of NSD1 in H2O2-induced GSTM3 suppression.
25040976 2014 Susceptibility of lung cancer with polymorphisms of CYP1A1, GSTM1, GSTM3, GSTT1 and GSTP1 genotypes in the population of Inner Mongolia region.
24689813 2015 The association of glutathione S-transferase polymorphisms in patients with osteosarcoma: evidence from a meta-analysis.
24416175 2014 GSTM3 A/B polymorphism and risk for head and neck cancer: a meta-analysis.
24157827 2013 Genetic variation in the GSTM3 promoter confer risk and prognosis of renal cell carcinoma by reducing gene expression.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23167362 2012 Lack of association of glutathione S-transferase M3 gene polymorphism with the susceptibility of lung cancer.
23036584 2013 Discovery by the Epistasis Project of an epistatic interaction between the GSTM3 gene and the HHEX/IDE/KIF11 locus in the risk of Alzheimer's disease.
More...