Property Summary

NCBI Gene PubMed Count 149
PubMed Score 90.63
PubTator Score 99.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia -1.100 3.4e-03
atypical teratoid / rhabdoid tumor -2.200 3.5e-07
Breast cancer -1.300 6.1e-05
colon cancer -2.400 1.7e-02
diabetes mellitus -1.100 3.2e-02
fibroadenoma 1.100 1.3e-02
glioblastoma -1.200 3.1e-06
group 3 medulloblastoma -1.500 1.4e-03
head and neck cancer -1.600 7.8e-03
intraductal papillary-mucinous carcinoma... -2.000 2.7e-03
intraductal papillary-mucinous neoplasm ... -1.100 2.2e-02
invasive ductal carcinoma -1.291 4.0e-03
lung carcinoma 1.600 9.7e-10
malignant mesothelioma -4.300 5.3e-09
medulloblastoma, large-cell -1.800 2.5e-06
osteosarcoma 2.008 1.5e-03
ovarian cancer -3.000 6.9e-08
pediatric high grade glioma -1.500 5.5e-06
primitive neuroectodermal tumor -1.500 8.1e-03
psoriasis -1.300 7.1e-25
sarcoidosis -1.100 6.9e-05
tuberculosis and treatment for 3 months -1.200 2.3e-03
ulcerative colitis -1.400 1.2e-03

Protein-protein Interaction (10)

Gene RIF (141)

AA Sequence

MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDG      1 - 70
KNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLK     71 - 140
QFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKM    141 - 210
PINNKMAQWGNKPVC                                                           211 - 225
//

Text Mined References (151)

PMID Year Title