Property Summary

NCBI Gene PubMed Count 79
PubMed Score 330.06
PubTator Score 218.07

Knowledge Summary

Patent

No data available

Expression

 OMIM Phenotype (1)

Gene RIF (59)

AA Sequence

MDPLGAAKPQWPWRRCLAALLFQLLVAVCFFSYLRVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLWTW      1 - 70
PFHIPVALSRCSEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPP     71 - 140
PNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYY    141 - 210
QSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSN    211 - 280
YERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRY    281 - 350
QTVRSIAAWFT                                                               351 - 361
//

Text Mined References (80)

PMID Year Title