Property Summary

NCBI Gene PubMed Count 75
Grant Count 49
R01 Count 21
Funding $8,772,456.92
PubMed Score 305.04
PubTator Score 218.07

Knowledge Summary

Patent

No data available

Expression

Gene RIF (56)

PMID Text
26766790 Polymorphisms in FUT3 and its intestinal expression might be associated with ulcerative colitis pathogenesis.
26663064 Data suggest that fucosyltransferase 3 (FUT3) gene rs28362459 and rs3745635 single nucleotide polymorphisms (SNPs) may engender the increased risk of ileocolonic and ileal Crohn's disease (CD).
26321244 that the absence of alpha1,3/4-fucosyltransferase enzyme is related to breast's invasive breast carcinoma
24720527 Mutations of FUT3 (rs28362459) and (rs3745635) might influence the lesion locations in CD patients.
23958938 Use of FUT2/3 genotype-dependent cut-off values for CA19-9 improved sensitivity and reduced the number of false positive results
23922852 Obtained FST values reveal distinct frequencies of the FUT3 SNPs between the present sample and its representative ancestral populations.
21978830 down-regulation of FUT3 and FUT5 reduces the expression of sialyl-Lewis antigens and the adhesion capacities of gastric cancer cells and allows to identify the specific alpha1-3,4 fucosyltransferases implicated in the Lewis antigens synthesis
21542140 Elevated expression of Topo-I and Topo-II beta is found in Lewis(y) antigen-overexpressing ovarian cancer cells.
20833389 At physiological levels of wall shear stress, the number of flowing cancer cells recruited to the microtube surface was dramatically reduced by FUT3 knockdown
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MDPLGAAKPQWPWRRCLAALLFQLLVAVCFFSYLRVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLWTW      1 - 70
PFHIPVALSRCSEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPP     71 - 140
PNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYY    141 - 210
QSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSN    211 - 280
YERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRY    281 - 350
QTVRSIAAWFT                                                               351 - 361
//

Text Mined References (76)

PMID Year Title
26766790 2016 Association of Ulcerative Colitis with FUT2 and FUT3 Polymorphisms in Patients from Southeast China.
26663064 2015 [Association of inflammatory bowel disease with the polymorphisms and haplotypes of fucosyltransferase 3 gene].
26321244 2015 Fut3 role in breast invasive ductal carcinoma: Investigating its gene promoter and protein expression.
24941225 2014 Genetic variations affecting serum carcinoembryonic antigen levels and status of regional lymph nodes in patients with sporadic colorectal cancer from Southern China.
24720527 2014 Associations of FUT2 and FUT3 gene polymorphisms with Crohn's disease in Chinese patients.
23958938 2013 FUT2 and FUT3 genotype determines CA19-9 cut-off values for detection of cholangiocarcinoma in patients with primary sclerosing cholangitis.
23922852 2013 The Lewis histo-blood group system: molecular analysis of the 59T>G, 508G>A, and 1067T>A polymorphisms in an Amazonian population.
21978830 2011 Down-regulation of FUT3 and FUT5 by shRNA alters Lewis antigens expression and reduces the adhesion capacities of gastric cancer cells.
21542140 2011 Overexpression of Lewis(y) antigen protects ovarian cancer RMG-1 cells from carboplatin-induced apoptosis by the upregulation of Topo-I and Topo-II ?.
21203500 2010 Genomics meets glycomics-the first GWAS study of human N-Glycome identifies HNF1? as a master regulator of plasma protein fucosylation.
More...