Property Summary

NCBI Gene PubMed Count 62
PubMed Score 22.04
PubTator Score 86.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
adult high grade glioma -2.600 4.9e-04
astrocytic glioma -3.000 9.6e-03
Astrocytoma, Pilocytic -2.300 2.2e-05
atypical teratoid / rhabdoid tumor -3.200 3.2e-08
colon cancer -1.200 4.4e-02
Common variable immunodeficiency -1.200 3.6e-02
cystic fibrosis 1.900 1.4e-03
Down syndrome 1.200 4.0e-03
ependymoma -3.400 8.5e-03
esophageal adenocarcinoma -5.100 1.8e-02
gastric carcinoma -2.600 1.7e-02
glioblastoma -2.400 1.3e-05
group 3 medulloblastoma -4.900 5.0e-07
lung adenocarcinoma -1.800 5.7e-09
lung cancer -3.200 4.8e-06
lung carcinoma -1.100 4.5e-16
medulloblastoma, large-cell -3.200 3.2e-05
nasopharyngeal carcinoma -3.000 4.4e-06
nephrosclerosis -1.119 4.8e-02
non-small cell lung cancer -1.522 6.7e-10
oligodendroglioma -2.000 4.7e-02
osteosarcoma -2.665 4.1e-03
ovarian cancer 3.300 5.3e-04
Pick disease -1.300 3.7e-04
primitive neuroectodermal tumor -3.200 3.4e-05
psoriasis -2.100 3.2e-11
sarcoidosis -1.100 6.1e-04
spina bifida -1.550 4.0e-02
subependymal giant cell astrocytoma -4.434 3.6e-03
tuberculosis and treatment for 3 months 1.200 6.3e-04

Synonym

Accession P21145 Q6FH77
Symbols

Gene

MAL

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (46)

AA Sequence

MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLI      1 - 70
ILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYV     71 - 140
VHAVFSLIRWKSS                                                             141 - 153
//

Text Mined References (64)

PMID Year Title