Property Summary

NCBI Gene PubMed Count 59
Grant Count 10
R01 Count 5
Funding $691,328.8
PubMed Score 21.54
PubTator Score 86.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
nephrosclerosis -1.119 0.048
astrocytic glioma -3.000 0.010
ependymoma -3.400 0.008
oligodendroglioma -2.400 0.000
esophageal adenocarcinoma -5.100 0.018
psoriasis -2.100 0.000
glioblastoma -2.400 0.000
osteosarcoma -2.665 0.004
group 3 medulloblastoma -4.900 0.000
atypical teratoid/rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -3.200 0.000
tuberculosis and treatment for 3 months 1.200 0.001
non-small cell lung cancer -1.522 0.000
Common variable immunodeficiency -1.200 0.036
colon cancer -2.400 0.000
lung cancer -3.200 0.000
cystic fibrosis 1.900 0.001
pediatric high grade glioma -2.900 0.000
pilocytic astrocytoma -2.300 0.000
sarcoidosis -1.100 0.001
subependymal giant cell astrocytoma -4.434 0.004
lung adenocarcinoma -1.800 0.000
nasopharyngeal carcinoma -3.000 0.000
lung carcinoma -1.100 0.000
spina bifida -1.550 0.040
Pick disease -1.300 0.000
gastric carcinoma -2.600 0.017
ovarian cancer 3.300 0.001
Down syndrome 1.200 0.004

Gene RIF (43)

PMID Text
26772392 This study revealed that Merkel cell polyomavirus -negative Merkel cell carcinomas significantly expressed higher CADM1 and lower MAL than Merkel cell polyomavirus -positive Merkel cell carcinomas
26482433 Hypermethylation of the selected markers (MAL, PRIMA1, PTGDR and SFRP1) can result in reduced gene expression and may contribute to the formation of colorectal cancer.
26473640 The use of CADM1, MAL, and MIR124-2 as biomarkers for full molecular screening in HIV infected women who are also positive for human papillomavirus.
26219541 CADM1/MAL methylation increases with severity of cervical intraepithelial neoplasia
26109641 MAL is a critical element of the machinery for exosome secretion and may constitute a target for modulating exosome secretion by human T cells.
26109641 HIV-1 Nef interacts with MAL-dependent pathway to enhance exosome release
25993478 Data suggest that expression of MAL in cells confers both ETX (Clostridium perfringens epsilon-toxin) binding and susceptibility to ETX-mediated cell death; cells expressing rat MAL are 100 times more sensitive to ETX than cells expressing human MAL.
25667975 Cytology and bi-marker CADM1/MAL-methylation analysis perform complementary for CIN2+/CIN3+ detection when used as triage tool on cervical scrapes of HPV positive women.
25281766 DNA methylation analysis of CADM1, MAL and miR124-2 in cervical scrapes consistently detects cervical cancer
24840642 Docking and physicochemical studies indicated that BTK was involved in close contact with Tyr86 and Tyr106 of MAL, whereas PKCdelta may phosphorylate Tyr106 only.
More...

AA Sequence

MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLI      1 - 70
ILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYV     71 - 140
VHAVFSLIRWKSS                                                             141 - 153
//

Text Mined References (61)

PMID Year Title
26772392 2016 Lower expression of CADM1 and higher expression of MAL in Merkel cell carcinomas are associated with Merkel cell polyomavirus infection and better prognosis.
26482433 2015 DNA hypermethylation and decreased mRNA expression of MAL, PRIMA1, PTGDR and SFRP1 in colorectal adenoma and cancer.
26473640 2015 Methylation Levels of CADM1, MAL, and MIR124-2 in Cervical Scrapes for Triage of HIV-Infected, High-Risk HPV-Positive Women in Kenya.
26219541 2016 CADM1 and MAL methylation status in cervical scrapes is representative of the most severe underlying lesion in women with multiple cervical biopsies.
26109641 2015 Cutting Edge: Regulation of Exosome Secretion by the Integral MAL Protein in T Cells.
25993478 2015 The Myelin and Lymphocyte Protein MAL Is Required for Binding and Activity of Clostridium perfringens ?-Toxin.
25667975 2015 Follow-up of high-risk HPV positive women by combined cytology and bi-marker CADM1/MAL methylation analysis on cervical scrapes.
25416956 2014 A proteome-scale map of the human interactome network.
25281766 2014 CADM1, MAL and miR124-2 methylation analysis in cervical scrapes to detect cervical and endometrial cancer.
24840642 2014 Structural evaluation of BTK and PKC? mediated phosphorylation of MAL at positions Tyr86 and Tyr106.
More...