Property Summary

Ligand Count 1
NCBI Gene PubMed Count 60
PubMed Score 16.56
PubTator Score 102.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

 GWAS Trait (1)

Gene RIF (28)

AA Sequence

MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRRE      1 - 70
DSMEDRGEEDDSLAIKPPQQMSRKEKVHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREE     71 - 140
QDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARRE    141 - 210
VSAHHRTMREDYSDKVKASHWSRSPPRPPRERFELGDGRKPGEARPARAQKPAQLKEEKMEERDLLSDLQ    211 - 280
DISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEEEEETGSNSEEASEQSAE    281 - 350
EVSEEEMSEDEERENENHLLVVPESRFDRDSGESEEAEEEVGEGTPQSSALTEGDYVPDSPALSPIELKQ    351 - 420
ELPKYLPALQGCRSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINTIL    421 - 490
KAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLRGVKHLHDNWILH    491 - 560
RDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGE    561 - 630
LLTQKPLFPGKSEIDQINKVFKDLGTPSEKIWPGYSELPAVKKMTFSEHPYNNLRKRFGALLSDQGFDLM    631 - 700
NKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDL    701 - 770
KETGFHLTTTNQGASAAGPGFSLKF                                                 771 - 795
//

Text Mined References (72)

PMID Year Title