Property Summary

NCBI Gene PubMed Count 58
Grant Count 8
R01 Count 7
Funding $358,949.61
PubMed Score 15.88
PubTator Score 102.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Neuroblastoma 78 3.131 1.6

Synonym

Accession P21127 O95265 Q12817 Q12818 Q12819 Q12820 Q12822 Q8N530 Q9NZS5 Q9UBJ0 Q9UBQ1 Q9UBR0 Q9UNY2 Q9UP57 Q9UP58 Q9UP59
Symbols p58
PK58
CDK11
CLK-1
CDC2L1
PITSLREA
p58CLK-1
CDK11-p46
CDK11-p58
p58CDC2L1
CDK11-p110

Gene

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

 Collection (1)

Gene RIF (26)

PMID Text
26567509 CDK11 was found associated with the TREX/THOC, which recruited this kinase to DNA. Once at the viral genome, CDK11 phosphorylated serines at position 2 in the CTD of RNAPII, which increased levels of cleavage and polyadenylation factors at the HIV 3' end. In its absence, cleavage of viral transcripts was greatly attenuated.
26470709 Real-time PCR and dual-luciferase assay showed CDK11(p58) inhibited the mRNA levels of VEGF and the promoter activity of VEGF
25837326 CDK11 and CK2 expression are individually essential for breast cancer cell survival, including TNBC.
25576733 Hepsin suppressed CDK11p58 internal ribosome entry site activity in prostate cancer cells by modulating UNR expression and eIF-2alpha phosphorylation.
25348612 silencing induces cell death in osteosarcoma
25106495 Data indicate that CDK11p58 is an anti-metastatic gene in ERalpha-positive breast cancer and that the regulation of integrin beta3 by CDK11p58 via the repression of ERalpha signaling may constitute part of a signaling pathway underlying breast cancer invasion.
24436071 CDK11(p58) kinase activity appears to be involved in early events in the establishment of the centromere protection machinery.
24330569 CDK11 depletion reduces protein expression of CDK9 and HEXIM1 and Tat transactivation of HIV-1 provirus
24007862 CDK11 is critical for the growth and proliferation of liposarcoma cells.
23178491 CHK2 kinase constitutively phosphorylates CDK11(p110) in a DNA damage-independent manner.
More...

AA Sequence

MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRRE      1 - 70
DSMEDRGEEDDSLAIKPPQQMSRKEKVHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREE     71 - 140
QDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARRE    141 - 210
VSAHHRTMREDYSDKVKASHWSRSPPRPPRERFELGDGRKPGEARPARAQKPAQLKEEKMEERDLLSDLQ    211 - 280
DISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEEEEETGSNSEEASEQSAE    281 - 350
EVSEEEMSEDEERENENHLLVVPESRFDRDSGESEEAEEEVGEGTPQSSALTEGDYVPDSPALSPIELKQ    351 - 420
ELPKYLPALQGCRSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINTIL    421 - 490
KAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLRGVKHLHDNWILH    491 - 560
RDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGE    561 - 630
LLTQKPLFPGKSEIDQINKVFKDLGTPSEKIWPGYSELPAVKKMTFSEHPYNNLRKRFGALLSDQGFDLM    631 - 700
NKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDL    701 - 770
KETGFHLTTTNQGASAAGPGFSLKF                                                 771 - 795
//

Text Mined References (69)

PMID Year Title
26567509 2015 CDK11 in TREX/THOC Regulates HIV mRNA 3' End Processing.
26470709 2015 Critical role of CDK11(p58) in human breast cancer growth and angiogenesis.
25965346 2015 SP-R210 (Myo18A) Isoforms as Intrinsic Modulators of Macrophage Priming and Activation.
25837326 2015 Preclinical evaluation of cyclin dependent kinase 11 and casein kinase 2 survival kinases as RNA interference targets for triple negative breast cancer therapy.
25576733 2015 Hepsin inhibits CDK11p58 IRES activity by suppressing unr expression and eIF-2? phosphorylation in prostate cancer.
25348612 2015 Targeting CDK11 in osteosarcoma cells using the CRISPR-Cas9 system.
25106495 2014 CDK11p58 inhibits ER?-positive breast cancer invasion by targeting integrin ?3 via the repression of ER? signaling.
24436071 2014 CDK11(p58) kinase activity is required to protect sister chromatid cohesion at centromeres in mitosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24007862 2014 Cyclin-dependent kinase 11 (CDK11) is crucial in the growth of liposarcoma cells.
More...