Property Summary

NCBI Gene PubMed Count 6
PubMed Score 18.28
PubTator Score 2.94

Knowledge Summary

Patent

No data available

TINX Plot

Expression

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIDESVRGEDVYIVQSGCGEINDSLMEL      1 - 70
LIMINACKIASASRVTAVIPCFPYARQDKKDKSRSPISAKLVANMLSIAGADHIITMDLHASQIQGFFDI     71 - 140
PVDNLYAEPTVLKWIRENIPEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKERKKANEVDCIVLVGD    141 - 210
VNDRVAILVDDMADTCVTICLAADKLLSAGATRVYAILTHGIFSGPAISRINTACFEAVVVTNTIPQDEK    211 - 280
MKHCSKIRVIDISMILAEAIRRTHNGESVSYLFSHVPL                                    281 - 318
//

Text Mined References (7)

PMID Year Title