Property Summary

NCBI Gene PubMed Count 183
PubMed Score 375.07
PubTator Score 299.46

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 0.006
psoriasis 1.400 0.000
osteosarcoma -1.257 0.050
lung cancer -1.400 0.000
interstitial cystitis 1.400 0.003
lung carcinoma -1.100 0.000

Synonym

Accession P20963 B1AK49 Q5VX13 Q8TAX4
Symbols T3Z
CD3H
CD3Q
CD3Z
TCRZ
IMD25
CD3-ZETA

Gene

PDB

1YGR   1TCE   2OQ1   4XZ1   2HAC   3IK5   3IOZ  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (120)

PMID Text
26595239 Suggest 2'5'-oligoadenylate synthetase 2 mediates T-cell receptor CD3-zeta chain down-regulation via caspase-3 activation in oral cancer.
26207425 identified among the key genes in circulating monocytes that were altered by exercise
26134847 SRSF1 regulates CD3zeta expression in human T cells and may contribute to the T cell defect in systemic lupus erythematosus.
25970543 In localized colorectal cancer carriers, mRNA-based CD3Z/CD8 profiling of tumor immune response may have stage, site and tissue-specific prognostic significance, along with ESR1 expression.
25947381 T cell receptor (TCR)-CD3 complex and the Lck kinase were required for Ca(2+) mobilization but not for apoptosis induction in Jurkat cells.
25732729 a CD247 defect leads to the accumulation of naive, hyporesponsive gammadelta and alphabeta T cells in thymoma patient resulting in a novel type of acquired T cell immunodeficiency and immune dysregulation of clinical significance.
25661802 we observed decreased CD3 surface expression, reduced ZAP-70 abundance and increased histone H3-acetylation in activated T lymphocytes after 5 minutes of clinorotation and a transient downregulation of CD3 and stable downregulation of IL-2R
25569266 Our study independently confirms and extends the association of SLE with CD247, which is shared by various autoimmune disorders and supports a common T-cell-mediated mechanism.
25513989 Data indicate that the decreasing trend in the expression level of TCRzeta chain, ZAP-70 kinase and epsilon Fc Receptors FcvarepsilonRIgamma was significantly associated with disease progression.
25467409 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
More...

AA Sequence

MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQ      1 - 70
LYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG     71 - 140
LYQGLSTATKDTYDALHMQALPPR                                                  141 - 164
//

Text Mined References (191)

PMID Year Title
26783323 2016 A novel human autoimmune syndrome caused by combined hypomorphic and activating mutations in ZAP-70.
26595239 2016 Extracellular 2'5'-oligoadenylate synthetase 2 mediates T-cell receptor CD3-? chain down-regulation via caspase-3 activation in oral cancer.
26207425 2015 Brief Exercises Affect Gene Expression in Circulating Monocytes.
26134847 2015 Serine Arginine-Rich Splicing Factor 1 (SRSF1) Contributes to the Transcriptional Activation of CD3? in Human T Cells.
25970543 2015 Immune response gene expression in colorectal cancer carries distinct prognostic implications according to tissue, stage and site: a prospective retrospective translational study in the context of a hellenic cooperative oncology group randomised trial.
25947381 2015 Impact of Exogenous Galectin-9 on Human T Cells: CONTRIBUTION OF THE T CELL RECEPTOR COMPLEX TO ANTIGEN-INDEPENDENT ACTIVATION BUT NOT TO APOPTOSIS INDUCTION.
25732729 2015 A novel thymoma-associated immunodeficiency with increased naive T cells and reduced CD247 expression.
25661802 2015 Signal transduction in primary human T lymphocytes in altered gravity during parabolic flight and clinostat experiments.
25569266 2015 Genetic association of CD247 (CD3?) with SLE in a large-scale multiethnic study.
25513989 2015 Characteristics of TCR?, ZAP-70, and Fc?RI? gene expression in patients with T- and NK/T-cell lymphoma.
More...