Property Summary

NCBI Gene PubMed Count 192
PubMed Score 386.26
PubTator Score 299.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 6.2e-03
interstitial cystitis 1.400 2.8e-03
lung cancer -1.400 1.3e-04
lung carcinoma -1.100 2.0e-12
osteosarcoma -1.257 5.0e-02
psoriasis 1.400 1.5e-04

 OMIM Phenotype (1)

Gene RIF (127)

AA Sequence

MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQ      1 - 70
LYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG     71 - 140
LYQGLSTATKDTYDALHMQALPPR                                                  141 - 164
//

Text Mined References (204)

PMID Year Title