Property Summary

NCBI Gene PubMed Count 183
Grant Count 106
R01 Count 57
Funding $10,463,586.01
PubMed Score 375.07
PubTator Score 299.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 0.006
psoriasis 1.400 0.000
osteosarcoma -1.257 0.050
lung cancer -1.400 0.000
interstitial cystitis 1.400 0.003
lung carcinoma -1.100 0.000

Synonym

Accession P20963 B1AK49 Q5VX13 Q8TAX4
Symbols T3Z
CD3H
CD3Q
CD3Z
TCRZ
IMD25
CD3-ZETA

Gene

PDB

1YGR   1TCE   2OQ1   4XZ1   2HAC   3IK5   3IOZ  

Gene RIF (139)

PMID Text
26595239 Suggest 2'5'-oligoadenylate synthetase 2 mediates T-cell receptor CD3-zeta chain down-regulation via caspase-3 activation in oral cancer.
26207425 identified among the key genes in circulating monocytes that were altered by exercise
26134847 SRSF1 regulates CD3zeta expression in human T cells and may contribute to the T cell defect in systemic lupus erythematosus.
25970543 In localized colorectal cancer carriers, mRNA-based CD3Z/CD8 profiling of tumor immune response may have stage, site and tissue-specific prognostic significance, along with ESR1 expression.
25947381 T cell receptor (TCR)-CD3 complex and the Lck kinase were required for Ca(2+) mobilization but not for apoptosis induction in Jurkat cells.
25732729 a CD247 defect leads to the accumulation of naive, hyporesponsive gammadelta and alphabeta T cells in thymoma patient resulting in a novel type of acquired T cell immunodeficiency and immune dysregulation of clinical significance.
25661802 we observed decreased CD3 surface expression, reduced ZAP-70 abundance and increased histone H3-acetylation in activated T lymphocytes after 5 minutes of clinorotation and a transient downregulation of CD3 and stable downregulation of IL-2R
25569266 Our study independently confirms and extends the association of SLE with CD247, which is shared by various autoimmune disorders and supports a common T-cell-mediated mechanism.
25513989 Data indicate that the decreasing trend in the expression level of TCRzeta chain, ZAP-70 kinase and epsilon Fc Receptors FcvarepsilonRIgamma was significantly associated with disease progression.
25467409 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
More...

AA Sequence

MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQ      1 - 70
LYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG     71 - 140
LYQGLSTATKDTYDALHMQALPPR                                                  141 - 164
//

Text Mined References (191)

PMID Year Title
26783323 2016 A novel human autoimmune syndrome caused by combined hypomorphic and activating mutations in ZAP-70.
26595239 2016 Extracellular 2'5'-oligoadenylate synthetase 2 mediates T-cell receptor CD3-? chain down-regulation via caspase-3 activation in oral cancer.
26207425 2015 Brief Exercises Affect Gene Expression in Circulating Monocytes.
26134847 2015 Serine Arginine-Rich Splicing Factor 1 (SRSF1) Contributes to the Transcriptional Activation of CD3? in Human T Cells.
25970543 2015 Immune response gene expression in colorectal cancer carries distinct prognostic implications according to tissue, stage and site: a prospective retrospective translational study in the context of a hellenic cooperative oncology group randomised trial.
25947381 2015 Impact of Exogenous Galectin-9 on Human T Cells: CONTRIBUTION OF THE T CELL RECEPTOR COMPLEX TO ANTIGEN-INDEPENDENT ACTIVATION BUT NOT TO APOPTOSIS INDUCTION.
25732729 2015 A novel thymoma-associated immunodeficiency with increased naive T cells and reduced CD247 expression.
25661802 2015 Signal transduction in primary human T lymphocytes in altered gravity during parabolic flight and clinostat experiments.
25569266 2015 Genetic association of CD247 (CD3?) with SLE in a large-scale multiethnic study.
25513989 2015 Characteristics of TCR?, ZAP-70, and Fc?RI? gene expression in patients with T- and NK/T-cell lymphoma.
More...