Property Summary

NCBI Gene PubMed Count 30
Grant Count 134
R01 Count 49
Funding $39,424,434.96
PubMed Score 288.19
PubTator Score 105.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 2.100 0.016

Synonym

Accession P20941 Q14816 Q9UP22 Q9UP23 PHD
Symbols PHD
MEKA
PhLP
PhLOP

Gene

PDC

PANTHER Protein Class (2)

Gene RIF (9)

PMID Text
25153685 Phosducin regulates secretory activity in TT line of thyroid parafollicular C cells.
22365573 Data suggest that phosducin rs12402521 polymorphism is an important genetic predictor of obesity-related hypertension.
21191291 identification of Pdc as a gene for stress-induced hypertension offers new insights into the relationship between sympathetic nervous system activation, blood pressure regulation and genetic factors
20804785 Data suggest that the existence of a common epitope on the molecules of phosducin and beta-actin may reflect a topological similarity of a small region of their surfaces.
19959875 Candidate gene-based association studies in 2 different populations revealed several SNPs in the PDC gene to be associated with stress-dependent blood pressure phenotypes.
19454010 Interaction of HIV-1 Tat with PHD in T-cells is identified by a proteomic strategy based on affinity chromatography coupled with mass spectrometry
16421094 SUMO-1 controls the protein stability and the biological function of phosducin.
14758335 Observational study of gene-disease association. (HuGE Navigator)
14758335 Phosducin mutations are not a major cause of dominant or recessive retinitis pigmentosa, Leber congenital amaurosis, or cone-rod degeneration.

AA Sequence

MEEAKSQSLEEDFEGQATHTGPKGVINDWRKFKLESQDSDSIPPSKKEILRQMSSPQSRNGKDSKERVSR      1 - 70
KMSIQEYELIHKEKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGKQFLETIEKELKITTIVVHI     71 - 140
YEDGIKGCDALNSSLTCLAAEYPIVKFCKIKASNTGAGDRFSLDVLPTLLIYKGGELISNFISVAEQFAE    141 - 210
EFFAGDVESFLNEYGLLPEREVHVLEHTKIEEEDVE                                      211 - 246
//

Text Mined References (30)

PMID Year Title
25153685 2015 Phosducin regulates secretory activity in TT line of thyroid parafollicular C cells.
22365573 2013 Phosducin rs12402521 polymorphism predicts development of hypertension in young subjects with overweight or obesity.
21191291 2011 The identification of phosducin as a novel candidate gene for hypertension and its role in sympathetic activation.
20804785 2010 Phosducin and monomeric ?-actin have common epitope recognized by anti-phosducin antibodies.
19959875 2009 Phosducin influences sympathetic activity and prevents stress-induced hypertension in humans and mice.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16421094 2006 SUMO-1 controls the protein stability and the biological function of phosducin.
14758335 2004 Mutation screening of the phosducin gene PDC in patients with retinitis pigmentosa and allied diseases.
12500174 2002 Presence of phosducin in the nuclei of bovine retinal cells.
More...