Property Summary

NCBI Gene PubMed Count 30
PubMed Score 242.48
PubTator Score 105.09

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 2.100 1.6e-02

Gene RIF (9)

AA Sequence

MEEAKSQSLEEDFEGQATHTGPKGVINDWRKFKLESQDSDSIPPSKKEILRQMSSPQSRNGKDSKERVSR      1 - 70
KMSIQEYELIHKEKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGKQFLETIEKELKITTIVVHI     71 - 140
YEDGIKGCDALNSSLTCLAAEYPIVKFCKIKASNTGAGDRFSLDVLPTLLIYKGGELISNFISVAEQFAE    141 - 210
EFFAGDVESFLNEYGLLPEREVHVLEHTKIEEEDVE                                      211 - 246
//

Text Mined References (30)

PMID Year Title