Property Summary

NCBI Gene PubMed Count 185
PubMed Score 404.40
PubTator Score 334.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Endometrial cancer 311 0.0 0.6
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -1.200 7.1e-08
Chronic Lymphocytic Leukemia 1.312 3.8e-03
group 4 medulloblastoma 1.100 2.1e-02
intraductal papillary-mucinous neoplasm ... 1.400 9.7e-03
lung adenocarcinoma 1.071 6.7e-06
lung cancer -1.300 9.7e-03
ovarian cancer -2.000 4.0e-06
Pick disease -1.300 9.4e-04

Gene RIF (72)

AA Sequence

MMAAEAGSEEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPVAAAPYPGLVETGVAGTLGGGAALGSE      1 - 70
FLGAGSVAGALGGAGLTGGGTAAGVAGAAAGVAGAAVAGPSGDMALTKLPTSLLAETLGPGGGFPPLPPP     71 - 140
PYLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQWYHGKLDRTIAEERLRQAGKSGSYLIRESD    141 - 210
RRPGSFVLSFLSQMNVVNHFRIIAMCGDYYIGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVED    211 - 280
RRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKI    281 - 350
WFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIG    351 - 420
DIIDHYRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGYLLKKGKGKRW    421 - 490
KNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNCFQIVVQHFSEEHYIFYFAGE    491 - 560
TPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHIEEAHKLPVKHFTNPYCNIYLNSVQVAKTHA    561 - 630
REGQNPVWSEEFVFDDLPPDINRFEITLSNKTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKG    631 - 700
IEPGSLRVRARYSMEKIMPEEEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLL    701 - 770
CTLNDREISMEDEATTLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNED    771 - 840
VNTNLTHLLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFVFLRLICPAIL    841 - 910
NPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFIKSNKHRMIMFLDELGNVPEL    911 - 980
PDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQYTKTNDVR       981 - 1047
//

Text Mined References (194)

PMID Year Title