Property Summary

NCBI Gene PubMed Count 175
Grant Count 388
R01 Count 261
Funding $44,744,294.74
PubMed Score 375.11
PubTator Score 334.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.312 0.004
intraductal papillary-mucinous neoplasm ... 1.700 0.007
lung cancer -1.900 0.000
group 4 medulloblastoma 1.100 0.021
lung adenocarcinoma 1.071 0.000
Pick disease -1.300 0.001
Breast cancer -1.200 0.000
ovarian cancer -2.300 0.000

Synonym

Accession P20936 B2R6W3 B4DTL2 Q68CU6 Q9UDI1 GAP
Symbols GAP
PKWS
RASA
p120
CMAVM
CM-AVM
RASGAP
p120GAP
p120RASGAP

Gene

PDB

1WQ1   1WER   2GQI   2GSB   2J05   2J06   2M51   4FSS  

Gene RIF (64)

PMID Text
26840794 PTP1B dephosphorylates PITX1 to weaken its protein stability and the transcriptional activity for p120RasGAP gene expression
26710849 Data suggest that, in response to netrin-1/netrin receptor (DCC) signaling, p120RasGAP is recruited to growth cones and supports axon outgrowth; p120RasGAP Src homology 2 domains exhibit scaffolding properties sufficient to support axon outgrowth.
26192947 This is the second largest study on isolated, non-syndromic Port-wine stain; data suggest that GNAQ is the main genetic determinant in this condition. Moreover, isolated port-wine stains are distinct from capillary malformations seen in RASA1 disorders.
26126858 Data showed that hypoxia regulated the expression of miR-182 and RASA1 to promote HCC angiogenesis.
26109071 p120RasGAP shields Akt from deactivating phosphatases in FGF1 signaling, but loses this ability once cleaved by caspase-3.
26096958 Maternal and fetal capillary malformation-arteriovenous malformation due to a novel RASA1 mutation presenting with prenatal non-immune hydrops fetalis have been found.
25867276 Low RASA1 expression is associated with colorectal cancer.
25733681 Results show that report that RasGAP associates to PDGFRbeta and prevents its direct activation. This underlying mechanism raises the possibility that PDGFRbeta-mediated diseases involve indirect activation of PDGFRbeta.
25663768 miR-21 promotes malignant behaviors of colon cancer cells by regulating RASA1 expression via RAS pathways.
25394563 RASA1 expression is associated with breast cancer progression and poor survival and diseasefree survival of patients.
More...

AA Sequence

MMAAEAGSEEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPVAAAPYPGLVETGVAGTLGGGAALGSE      1 - 70
FLGAGSVAGALGGAGLTGGGTAAGVAGAAAGVAGAAVAGPSGDMALTKLPTSLLAETLGPGGGFPPLPPP     71 - 140
PYLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQWYHGKLDRTIAEERLRQAGKSGSYLIRESD    141 - 210
RRPGSFVLSFLSQMNVVNHFRIIAMCGDYYIGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVED    211 - 280
RRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKI    281 - 350
WFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIG    351 - 420
DIIDHYRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGYLLKKGKGKRW    421 - 490
KNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNCFQIVVQHFSEEHYIFYFAGE    491 - 560
TPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHIEEAHKLPVKHFTNPYCNIYLNSVQVAKTHA    561 - 630
REGQNPVWSEEFVFDDLPPDINRFEITLSNKTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKG    631 - 700
IEPGSLRVRARYSMEKIMPEEEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLL    701 - 770
CTLNDREISMEDEATTLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNED    771 - 840
VNTNLTHLLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFVFLRLICPAIL    841 - 910
NPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFIKSNKHRMIMFLDELGNVPEL    911 - 980
PDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQYTKTNDVR       981 - 1047
//

Text Mined References (184)

PMID Year Title
26840794 2016 Protein tyrosine phosphatase 1B dephosphorylates PITX1 and regulates p120RasGAP in hepatocellular carcinoma.
26710849 2016 p120RasGAP Protein Mediates Netrin-1 Protein-induced Cortical Axon Outgrowth and Guidance.
26192947 2015 Genetic Variants Associated with Port-Wine Stains.
26126858 2015 Hypoxia-inducible MiR-182 promotes angiogenesis by targeting RASA1 in hepatocellular carcinoma.
26109071 2015 RasGAP Shields Akt from Deactivating Phosphatases in Fibroblast Growth Factor Signaling but Loses This Ability Once Cleaved by Caspase-3.
26096958 2015 Maternal and fetal capillary malformation-arteriovenous malformation (CM-AVM) due to a novel RASA1 mutation presenting with prenatal non-immune hydrops fetalis.
25867276 2015 C/EBP-?-activated microRNA-223 promotes tumour growth through targeting RASA1 in human colorectal cancer.
25733681 2015 RasGAP Promotes Autophagy and Thereby Suppresses Platelet-Derived Growth Factor Receptor-Mediated Signaling Events, Cellular Responses, and Pathology.
25663768 2015 MiR-21/RASA1 axis affects malignancy of colon cancer cells via RAS pathways.
25394563 2015 Downregulation of Ras GTPase?activating protein 1 is associated with poor survival of breast invasive ductal carcinoma patients.
More...