Property Summary

NCBI Gene PubMed Count 15
Grant Count 7
R01 Count 5
Funding $456,147.44
PubMed Score 66.58
PubTator Score 21.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.000

Synonym

Accession P20853 Q13121
Symbols CPA7
CPAD
CYP2A
CYPIIA7
P450-IIA4

Gene

Gene RIF (4)

PMID Text
25710939 CYP2A7 affects CYP2A6 expression by competing for miR-126* binding.
16636685 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
12325023 Observational study of genotype prevalence. (HuGE Navigator)
11960914 CYP2A6/2A7 and CYP2E1 expression in human oesophageal mucosa: regional and inter-individual variation in expression and relevance to nitrosamine metabolism

AA Sequence

MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEHICDSIMKFSECYGPVFT      1 - 70
IHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVAFSNGERAKQLLRFAIATLRDFGV     71 - 140
GKRGIEERIQEESGFLIEAIRSTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLSMMLGIFQ    141 - 210
FTSTSTGQLYEMFSSVMKHLPGPQQQAFKLLQGLEDFIAKKVEHNQRTLDPNSPQDFIDSFLIHMQEEEK    211 - 280
NPNTEFYLKNLMMSTLNLFIAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRTKMP    281 - 350
YMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLDDK    351 - 420
GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVVFATIPRNYTMS    421 - 490
FLPR                                                                      491 - 494
//

Text Mined References (16)

PMID Year Title
25710939 2015 CYP2A7 pseudogene transcript affects CYP2A6 expression in human liver by acting as a decoy for miR-126.
22890016 2012 Differential distribution of CYP2A6 and CYP2A13 in the human respiratory tract.
16636685 CYP2A7 polymorphic alleles confound the genotyping of CYP2A6*4A allele.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12325023 2002 Characterization of a novel CYP2A7/CYP2A6 hybrid allele (CYP2A6*12) that causes reduced CYP2A6 activity.
11960914 2002 CYP2A6/2A7 and CYP2E1 expression in human oesophageal mucosa: regional and inter-individual variation in expression and relevance to nitrosamine metabolism.
10493259 1999 The CYP2A subfamily: function, expression and genetic polymorphism.
10353262 1999 Expression of CYP2A genes in human liver and extrahepatic tissues.
More...