Property Summary

NCBI Gene PubMed Count 16
PubMed Score 70.61
PubTator Score 21.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 2.4e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 3.0
Disease Target Count Z-score Confidence
Intermittent claudication 20 3.358 1.7
Malignant hyperthermia 26 3.234 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 2.4e-04

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEHICDSIMKFSECYGPVFT      1 - 70
IHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVAFSNGERAKQLLRFAIATLRDFGV     71 - 140
GKRGIEERIQEESGFLIEAIRSTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLSMMLGIFQ    141 - 210
FTSTSTGQLYEMFSSVMKHLPGPQQQAFKLLQGLEDFIAKKVEHNQRTLDPNSPQDFIDSFLIHMQEEEK    211 - 280
NPNTEFYLKNLMMSTLNLFIAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRTKMP    281 - 350
YMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLDDK    351 - 420
GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVVFATIPRNYTMS    421 - 490
FLPR                                                                      491 - 494
//

Text Mined References (17)

PMID Year Title