Property Summary

NCBI Gene PubMed Count 39
PubMed Score 9.27
PubTator Score 16.89

Knowledge Summary

Patent

No data available

Expression

Gene RIF (26)

AA Sequence

MFFWCACCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLVGKKTLFCNASKEWD      1 - 70
NTTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRSQCLEDHTWAPPFPICKSRDCD     71 - 140
PPGNPVHGYFEGNNFTLGSTISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPKPECEKALLAFQ    141 - 210
ESKNLCEAMENFMQQLKESGMTMEELKYSLELKKAELKAKLL                                211 - 252
//

Text Mined References (41)

PMID Year Title