Property Summary

NCBI Gene PubMed Count 37
PubMed Score 8.66
PubTator Score 16.89

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P20851 A5JYP8 D3DT81 Q5VVR0 Q9BS25
Symbols C4BP

Gene

Gene RIF (24)

PMID Text
26897815 C4BP is deposited in the diseased aortic valve, coincident with C3d expression.
25660618 C4BPB/C4BPA may not confer susceptibility to schizophrenia among Han Chinese
24064215 Binding of complement inhibitor C4b-binding protein to a highly virulent Streptococcus pyogenes M1 strain is mediated by protein H and enhances adhesion to and invasion of endothelial cells.
23390292 C4BP alpha7beta0 subunit [C4BP alpha7beta0 isoform lacking the beta-chain] induces a semimature, tolerogenic state on human monocyte-derived dendritic cells activated by a proinflammatory stimulus.
22514678 Since FI requires cofactors for its activity we also investigated the binding of purified cofactors C4BP and FH and found acquisition of both proteins, which retained their activity in FI mediated degradation of C3b and C4b.
21856004 crystallographic data on the structure of CD11c/CD18 and prediction of the secondary structure of the C4BP oligomerization domain, we show that epitopes bound by KIM185 in these proteins are unlikely to share any major structural similarity.
20693287 Results demonstrate that successful secretion of complement regulatory protein C4b-binding protein beta-chains depends on intracellular complex formation with vitamin K-dependent protein S, but not on the alpha-chains.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MFFWCACCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLVGKKTLFCNASKEWD      1 - 70
NTTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRSQCLEDHTWAPPFPICKSRDCD     71 - 140
PPGNPVHGYFEGNNFTLGSTISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPKPECEKALLAFQ    141 - 210
ESKNLCEAMENFMQQLKESGMTMEELKYSLELKKAELKAKLL                                211 - 252
//

Text Mined References (39)

PMID Year Title
26897815 2015 C4b-Binding Protein Deposition is Induced in Diseased Aortic Heart Valves, Coinciding with C3d.
25660618 2015 An evaluation of association between common variants in C4BPB/C4BPA genes and schizophrenia.
24064215 2013 Binding of complement inhibitor C4b-binding protein to a highly virulent Streptococcus pyogenes M1 strain is mediated by protein H and enhances adhesion to and invasion of endothelial cells.
23390292 2013 The ?7?0 isoform of the complement regulator C4b-binding protein induces a semimature, anti-inflammatory state in dendritic cells.
22514678 2012 Acquisition of complement inhibitor serine protease factor I and its cofactors C4b-binding protein and factor H by Prevotella intermedia.
22333221 2012 Complement regulator C4BP binds to Staphylococcus aureus and decreases opsonization.
21856004 2011 The role of higher-order protein structure in supporting binding by heteroclitic monoclonal antibodies: the monoclonal antibody KIM185 to CD18 also binds C4-binding protein.
20693287 2010 Dependence on vitamin K-dependent protein S for eukaryotic cell secretion of the beta-chain of C4b-binding protein.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
More...