Property Summary

Ligand Count 99
NCBI Gene PubMed Count 52
PubMed Score 91.86
PubTator Score 89.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
tuberculosis 2010 5.5e-09
psoriasis 6694 3.2e-04
inflammatory breast cancer 286 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Bartter disease type 3 3 3.099 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
inflammatory breast cancer 1.400 1.6e-02
psoriasis 1.600 3.2e-04
tuberculosis 1.400 5.5e-09

Gene RIF (35)

AA Sequence

MADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPM      1 - 70
DTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFS     71 - 140
GIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLP    141 - 210
IVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNS    211 - 280
VYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKV    281 - 350
AEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAM    351 - 420
EKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKF    421 - 490
EKRTMSAQIEGGVHGLHSYEKRLY                                                  491 - 514
//

Text Mined References (53)

PMID Year Title