Property Summary

NCBI Gene PubMed Count 74
Grant Count 77
R01 Count 51
Funding $3,669,484.57
PubMed Score 94.49
PubTator Score 122.49

Knowledge Summary

Patent (38,196)

Expression

  Differential Expression (17)

Synonym

Accession P20827 D3DV86 Q5SR60 Q5SR61 Q6I9T9 Q8N578
Symbols B61
EFL1
ECKLG
EPLG1
LERK1
LERK-1
TNFAIP4

Gene

PDB

3CZU   3HEI   3MBW  

Gene RIF (39)

PMID Text
24969670 Findings show that EFNA1 expression is a useful marker for predicting a high risk of recurrence in hepatocellular carcinoma patients but not EPHA2.
24853748 EphA2-ephrinA1 trans-endocytosis is sensitive to the mechanical properties of a cell's microenvironment
24330498 Expression of EPHRIN-A1 tends to be associated with worse survival in head and neck cancer.
24175772 Results suggest that EFNA1 is involved in colorectal tumorigenesis, and rs12904 A>G polymorphism in the 3' UTR of EFNA1 is associated with CRC susceptibility in a Chinese population.
24040255 Ephrin-A1 is upregulated in tumor microenvironment and promotes angiogenesis through a coordinated cross-talk with PI3K/Akt-dependent eNOS activation.
23686814 The interaction between ephrin-As, Eph receptors and integrin alpha3 is plausibly important for the crosstalk between Eph and integrin signalling pathways at the membrane protrusions and in the migration of brain cancer cells.
23661698 Findings suggest that the glycosylation on ephrin-A1 plays a critical role in the binding and activation of the EphA2 receptor.
23298804 present study showed a high expression of EphA2/ephrinA1 in adenoid cystic carcinoma. EphA2/ephrinA1 can serve as a novel therapy target for adenoid cystic carcinoma.
23258614 EFNA1 expression is a useful marker for predicting high risk of relapse and cancer-related death in patients who have undergone curative resection for CRC.
23065816 Increased expression of EFNA1 mRNA is associated with gastric cancer.
22824143 EphA2 activation by ephrin-A1 induces tumor suppressor gene cdx-2 expression which attenuates cell proliferation, tumor growth and thus may be a promising therapeutic target against NSCLC.
22236865 in p-stage I NSCLC patients, those in the higher EphA2 expression and higher ephrin-A1 expression groups shared almost the same clinicopathological backgrounds which are generally considered to be better prognostic factors.
22228563 The EphA2 ligand EphrinA1 induces EphA2 phosphorylation and intracellular internalization and degradation, thus inhibiting breast tumor progression.
22040911 Multiple oncogenic signalling pathways are affected by ephrin-A1, from the promotion of a specific pathway in one cell or cancer type to the inhibition of the same pathway in another type of cell or cancer. [Review]
21500549 Ovarian serous carcinomas and ovarian cancer cell lines overexpress EphA2 and EphrinA-1. Tumor patients with higher expression levels of both EphA2 and EphrinA-1 have a significantly poorer clinical outcome.
21415392 Ephrin A1 promotes the motility of EphA2-positive cardiac stem cells, facilitates their migration to the area of damage, and enhances cardiac repair
21349856 The Eph-ephrinA system can promote cell attachment along with intercellular dissociation.
21166698 Osteosarcoma samples were characterized using genome-wide microarrays: increased expression of the EphA2 receptor and its ligand EFNA1 was detected.
21138904 This study demonstrated that the Eph-ephrin A system can promote intercellular dissociation in Ishikawa cells suggesting an important role in the initial step of embryo implantation by opening the endometrial epithelial cell barrier.
20571968 up-regulation of EphA2 and down-regulation of Ephrina1 may correlate with poor prognosis for patients with high-grade glioma
19950554 EphA2 and EphrinA1 are highly expressed in renal cell carcinoma, and positively correlated with histological differentiation, clinical stage and angiogenesis.
19642143 EFNA1 may be a useful serum marker for the detection of hepatocellular carinoma development and progression.
19525919 The crystal structures of an A-class complex between EphA2 and ephrin-A1 and of unbound EphA2, are presented.
19101799 Increased expression of EphA2 and EphrinA-1 plays an important role in the progression human gastric adenocarcinoma.
19074825 The function of EphA2 and ephrinA1 in tumorigenesis and tumor progression is complex and seems to be dependent on cell type and microenvironment
18794797 Soluble monmomeric EphrinA1 is released from tumor cells and is a functional ligand for the EphA2 receptor.
17980912 Increasing ephrin-A expression enhances T-cell interactions not only with purified integrin ligands but also endothelial cells, while EphA activation down-regulates these interactions.
17332925 Ephrin-A1 serves as a critical negative regulator in the tumorigenesis of gliomas by down-regulating EphA2 and FAK.
17049832 Activation of ERK-1/2 plays an essential role in ephrin-A1-mediated cell migration, whixh is inhibited by green tea catechin epigallocatechin gallate.
16428472 High expression of Ephrin A-1 is associated with urinary bladder carcinoma.
16051609 low molecular weight protein-tyrosine phosphatase acts as terminator of EphA2 signaling causing efficient negative feedback loop on biological response mediated by ephrinA1; tyrosine phosphorylation main event orchestrating repulsive response
15649254 EPHA2 and EFNA1 expression may influence the behavior of human gastric cancer.
15585656 ephrin-A1 is expressed by venule endothelial cells
15193868 found ephrin-A1 expressed exclusively in the invasive extravillous trophoblast in preeclampsia and normal placenta
14707054 This study demonstrates for the first time significantly reduced ephrin-A1 expression in T cells of asthma patients.
14692877 A new ephrin-A1 isoform, ephrin-A1b, lacks a segment of 22 amino acids (residues 131-152). Exon 3 is spliced out in its transcript. It may regulate the function of its ephrin-A1a counterpart.
12794130 Ephrin-A1 stimulation of Jurkat T cells induces tyrosine phosphorylation of EphA3 receptors and cytoplasmic proteins, including c-cbl proto-oncogene, and causes down-regulation of endogenous EphA3 receptors from the cell surface and their degradation.
12496371 This protein, an EphA ligand, stimulated protein degradation by EphA2.
12496364 The interaction between EphA2 and this ligand protein is necessary for induction of maximal neovascularization by VEGF.

AA Sequence

MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILY      1 - 70
LVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRC     71 - 140
LRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLLQTP         141 - 205
//

Text Mined References (75)

PMID Year Title
24969670 2014 Association between ephrin-A1 mRNA expression and poor prognosis after hepatectomy to treat hepatocellular carcinoma.
24853748 2014 Spatial organization of EphA2 at the cell-cell interface modulates trans-endocytosis of ephrinA1.
24330498 2013 Expression of EPHRIN-A1, SCINDERIN and MHC class I molecules in head and neck cancers and relationship with the prognostic value of intratumoral CD8+ T cells.
24175772 2013 rs12904 polymorphism in the 3'UTR of EFNA1 is associated with colorectal cancer susceptibility in a Chinese population.
24040255 2013 Ephrin-A1 is up-regulated by hypoxia in cancer cells and promotes angiogenesis of HUVECs through a coordinated cross-talk with eNOS.
23686814 2013 Ephrin-As, Eph receptors and integrin ?3 interact and colocalise at membrane protrusions of U251MG glioblastoma cells.
23661698 2013 Biological and structural characterization of glycosylation on ephrin-A1, a preferred ligand for EphA2 receptor tyrosine kinase.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23298804 2013 EphA2/ephrinA1 mRNA expression and protein production in adenoid cystic carcinoma of salivary gland.
23258614 2013 Ephrin-A1 mRNA is associated with poor prognosis of colorectal cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23065816 2014 G-A variant in miR-200c binding site of EFNA1 alters susceptibility to gastric cancer.
22824143 2012 Ephrin-A1 inhibits NSCLC tumor growth via induction of Cdx-2 a tumor suppressor gene.
22236865 2012 Higher expression of EphA2 and ephrin-A1 is related to favorable clinicopathological features in pathological stage I non-small cell lung carcinoma.
22228563 2012 EphrinA1-EphA2 interaction-mediated apoptosis and FMS-like tyrosine kinase 3 receptor ligand-induced immunotherapy inhibit tumor growth in a breast cancer mouse model.
22040911 2012 Ephs and ephrins in cancer: ephrin-A1 signalling.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21500549 2011 [Expression and prognostic significance of EphA2 and EphrinA-1 in ovarian serous carcinomas].
21415392 2011 The ephrin A1-EphA2 system promotes cardiac stem cell migration after infarction.
21349856 2011 EphrinA1 stimulates cell attachment and inhibits cell aggregation through the EphA receptor pathway in human endometrial carcinoma-derived Ishikawa cells.
21166698 2010 De novo expression of EphA2 in osteosarcoma modulates activation of the mitogenic signalling pathway.
21138904 2011 Ephrin A1 induces intercellular dissociation in Ishikawa cells: possible implication of the Eph-ephrin A system in human embryo implantation.
20571968 2010 Up-regulation of EphA2 and down-regulation of EphrinA1 are associated with the aggressive phenotype and poor prognosis of malignant glioma.
20505120 2010 Architecture of Eph receptor clusters.
20154726 2010 A potential tumor suppressor role for Hic1 in breast cancer through transcriptional repression of ephrin-A1.
19950554 2009 [Expression of EphA2 and EphrinA1 in human renal cell carcinoma and its relationship with angiogenesis].
19642143 2010 EFNA1 ligand and its receptor EphA2: potential biomarkers for hepatocellular carcinoma.
19573808 2009 EphA2 mediates ligand-dependent inhibition and ligand-independent promotion of cell migration and invasion via a reciprocal regulatory loop with Akt.
19525919 2009 Ligand recognition by A-class Eph receptors: crystal structures of the EphA2 ligand-binding domain and the EphA2/ephrin-A1 complex.
19101799 2009 Over-expression of EphA2 and EphrinA-1 in human gastric adenocarcinoma and its prognostic value for postoperative patients.
19074825 2008 The EphA2 receptor and ephrinA1 ligand in solid tumors: function and therapeutic targeting.
18794797 2008 Soluble monomeric EphrinA1 is released from tumor cells and is a functional ligand for the EphA2 receptor.
17980912 2008 EphA and ephrin-A proteins regulate integrin-mediated T lymphocyte interactions.
17332925 2007 Ephrin-A1 is a negative regulator in glioma through down-regulation of EphA2 and FAK.
17049832 2007 Green tea catechin inhibits ephrin-A1-mediated cell migration and angiogenesis of human umbilical vein endothelial cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16428472 2006 Expression of EphA2 and Ephrin A-1 in carcinoma of the urinary bladder.
16239146 2005 Adam meets Eph: an ADAM substrate recognition module acts as a molecular switch for ephrin cleavage in trans.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16051609 2005 EphrinA1 repulsive response is regulated by an EphA2 tyrosine phosphatase.
15777695 2005 Characterization of a novel Eph receptor tyrosine kinase, EphA10, expressed in testis.
15649254 2005 EPHA2/EFNA1 expression in human gastric cancer.
15585656 2005 Ephrin-A1 binding to CD4+ T lymphocytes stimulates migration and induces tyrosine phosphorylation of PYK2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15193868 2004 Eph and ephrin expression in normal placental development and preeclampsia.
14707054 2004 Ephrin-A1 suppresses Th2 cell activation and provides a regulatory link to lung epithelial cells.
14692877 2004 A new ephrin-A1 isoform (ephrin-A1b) with altered receptor binding properties abrogates the cleavage of ephrin-A1a.
12794130 2003 Ephrin-A1 induces c-Cbl phosphorylation and EphA receptor down-regulation in T cells.
12496371 2002 c-Cbl-dependent EphA2 protein degradation is induced by ligand binding.
12496364 2002 Blockade of EphA receptor tyrosine kinase activation inhibits vascular endothelial cell growth factor-induced angiogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11519828 2001 Characterization of the Epha1 receptor tyrosine kinase: expression in epithelial tissues.
11278560 2001 Modulation of oncogenic DBL activity by phosphoinositol phosphate binding to pleckstrin homology domain.
11256076 2001 Multiple roles of EPH receptors and ephrins in neural development.
11128993 2000 Roles of Eph receptors and ephrins in segmental patterning.
10730216 2000 Eph receptors and ephrins: regulators of guidance and assembly.
10655584 2000 Activation of EphA2 kinase suppresses integrin function and causes focal-adhesion-kinase dephosphorylation.
10515610 1999 Characterization of ephrin-A1 and ephrin-A4 as ligands for the EphA8 receptor protein tyrosine kinase.
10502115 1999 Signal transfer by eph receptors
10341214 1999 EGF-and NGF-stimulated translocation of cytohesin-1 to the plasma membrane of PC12 cells requires PI 3-kinase activation and a functional cytohesin-1 PH domain.
10207129 1999 Eph receptors and ephrins: effectors of morphogenesis.
9693361 1998 The PH domain and the polybasic c domain of cytohesin-1 cooperate specifically in plasma membrane association and cellular function.
9576626 1998 The Eph family receptors and ligands.
9530499 1998 The ephrins and Eph receptors in neural development.
9267020 1997 Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee.
8755474 1996 Eph receptors and ligands comprise two major specificity subclasses and are reciprocally compartmentalized during embryogenesis.
8660976 1996 The genes encoding the eph-related receptor tyrosine kinase ligands LERK-1 (EPLG1, Epl1), LERK-3 (EPLG3, Epl3), and LERK-4 (EPLG4, Epl4) are clustered on human chromosome 1 and mouse chromosome 3.
8542290 1995 Cell signalling. Receptor orphans find a family.
8070404 1994 Molecular characterization of a family of ligands for eph-related tyrosine kinase receptors.
7973638 1994 Ligands for EPH-related receptor tyrosine kinases that require membrane attachment or clustering for activity.
7838529 1995 Ligands for the receptor tyrosine kinases hek and elk: isolation of cDNAs encoding a family of proteins.
7619809 1995 Structural studies on the PH domains of Db1, Sos1, IRS-1, and beta ARK1 and their differential binding to G beta gamma subunits.
2233719 1990 A novel immediate-early response gene of endothelium is induced by cytokines and encodes a secreted protein.